ISLpl4

  • Family IS982
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
AJ968657 ND Lactobacillus plantarum
Oenococcus oeni
Lactobacillus plantarum CECT 4645
Lactobacillus plantarum
Leuconostoc mesenteroides
Lactobacillus sakei
DNA section
IS Length : 985 bp

Ends


IR Length : 29/35

IRL : ACGCGTGGTGCTAGTTTGTAATAATACAAAAAAATTAACAAAAAAGTCCA
IRR : ACGCGTGGTGCTAGTTCGTCACAAAATTAAAAAATCCTAAATTATAGACT

Insertion site


Left flankDirect repeatRight flankDR Length
TTATATGCTAACATAATTAC8
CTTTATGCTCTAGTATTAAG8
TACTATGTGTTAACTAAAAA8

DNA sequence

ACGCGTGGTGCTAGTTTGTAATAATACAAAAAAATTAACAAAAAAGTCCAACACAGTTAGACTCATAAGTGACTAAACTTAAAAGGAGTCCTAACGATGT
TGAACCATCCTAAGTTTAAACAAATTCGTCACGAATTACAAGGTAACTATCATTATTTTTATCAGCTGTGCCAGTCGCTTTACCAGCGCTATTGCCCACG
TTGTGTGACGCAACGGCGTAATGTGGCGCACGTTAAAATCGATGACTGTCGATTGTTGGCGCTACTGTGTTTACAAACAACGCTTGGTATCCAATCACAA
CGCCGTTTTTGGCGCTTGATGACCGCCTTTATGCCGCAAAAAATCACCATTAGTCGGTCACGGTTCAACCGTCGCGCACTACAATTATTACCCGTGGTCA
ATGCGATCCGTACTGGTTTGACGCGTGAAGCAGCCCAACCTGGACAGATCGCAATCATTGATAGTTTGCCGAATCCATTGTGTGAACCAGTACGTAAATT
TAGAGCACGTATTTTTGCTGGGCAAGCTAATATTGGCTACAATGCCACTAAGCAAATGTCGTTCTATGGGTTTAAAACCCACATGCTAGTAACCACTGAT
GGCTACATTCTGAATTATGTGGTGACTGCCGCTTCGGTCCATGATACAAAAGTTGCCGTTAGCTTGATTGATGATTGTCCTTGTCCAATTGTTTTGGCCG
ATGTCGGTTATGTAGGCAAGCGACTTGGCGCTGAATTTAAGCAATTAGGCTACACGTTATGGACACCATACCGTTCGAATATGAAGGGGGCCAAGGAACA
TAATAAGCGCGCACTCAAGGCGTTACGTCGCACAATTGAATCGCGTTTTTCTACCTTAGTTAGTGATTTTGGAATTGAAACTAACTTAACGCGGAGTGCC
TTTGGCTTTCAACTAAAAATTGAACTGGCAATTTTAGTCTATAATTTAGGATTTTTTAATTTTGTGACGAACTAGCACCACGCGT
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
879 bp292 aa97975+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MLNHPKFKQIRHELQGNYHYFYQLCQSLYQRYCPRCVTQRRNVAHVKIDDCRLLALLCLQTTLGIQSQRRFWRLMTAFMPQKITISRSRFNRRALQLLPV
VNAIRTGLTREAAQPGQIAIIDSLPNPLCEPVRKFRARIFAGQANIGYNATKQMSFYGFKTHMLVTTDGYILNYVVTAASVHDTKVAVSLIDDCPCPIVL
ADVGYVGKRLGAEFKQLGYTLWTPYRSNMKGAKEHNKRALKALRRTIESRFSTLVSDFGIETNLTRSAFGFQLKIELAILVYNLGFFNFVTN

 

Blast result :
Comments
ISLpl4 is 63% aa similar to ISScr1. There are 8 copies of ISLpl4 IS in Lactobacillus plantarum CECT 4645 (NCFB 965).
An ISLpl4 copy of O. oeni contained a +1 nucleotide insertion on its transposase encoding gene and, by using anexperimental system, we were able to demonstrate that this specific sequence originates a +1 programmed translational frameshifting. Although the frameshifting process reported here operates at a low rate, this description might represent the first case of a functional +1 frameshifting among IS.
References
1] R. Muñoz (2005) Direct submission.
2] Blanca de las Rivas, Áng ela Marcobal, Alicia Gómez, Rosario Muñoz (2005), Gene 363,202–210