ISFsp1

  • Family ISL3
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
NZ_AAII01000234 ND Frankia sp.
Frankia sp. EAN1pec
DNA section
IS Length : 1732 bp

Ends


IR Length : 34/36

IRL : GATCTGGCCCTGATCTTGTGATCGGAGTGGCCCCGGGGGTGCCTGCTACC
IRR : GATCTGGCCCTGATCTTGTGATCGAAGTGGACCCGGGCGGCGGTCAGGTC

Insertion site


Left flankDirect repeatRight flankDR Length
GTTTTCATGTTCACACTTGAATCCC GTAGAGCCAC3

DNA sequence

GATCTGGCCCTGATCTTGTGATCGGAGTGGCCCCGGGGGTGCCTGCTACCTGAGGCCGGCCTGCTGTGATCATGTGCCGGGTGCCTCTCTGACCTTGGGG
TCCTGCTTCCGCATCTGGCGGGTCTGATCGTCGACCGCGTCGACCGGACTGGTGATCGCTTGCGGTTGTGGGCCCGTGTTCGAGGGCCGGGTGGGGCCTG
TCCAGGCTGCGGGGTGGTCTCGGAGCGGGTGCATGGCCGGTATCGGCGGCGGTTGGTCGATGCTGCCATCGGGGGTACCCACGTCGAGATCGATCTGCTG
GTCCGGCGGTTCCGTTGCCTGGACTCGGGATGTTCGAGGGTGACGTTCGCGGAGCAGGTCGTGGGTCTGACGAGTCCACATGCCCGGTTCACCCCACTCG
CCACCGGGATGATCGAGGCGATCGGGTTGGCGCTGGCGGGCAGGGCCGGTTCGCGTCTCGCCGGGCGGGTGGGGCTGTGTGCTGGCCGGAACACGGTGCT
GCGTCGGGTGCGGGCGTTACCCGATCCGCAGGTGGGTGTCGTGGCGACCCTCGGTGTGGACGATTTCGCGGTGCGTCGGGGCCGGGTCTACGGAACGGTC
CTGGTCGATCTGGACCGTCACCGGCCGGTGGACCTGCTCGCGGATCGGGAGGCAGCGACGTTCGCCGGCTGGCTGGCCGAGCATCCCGGTGCGCAGGTGA
TCTGCCGGGATCGGGCCGGTGCCTACGCCGACGGTGCCCGTACCGGTGCACCGGACGCGGTGGAAGTGGCTGACAGGTGGCATCTGTGGCACAACCTCGC
CGGGCACGTCGAGGCGACTGTCGCCCGCCATCGTTCCTGCCTGAAAGAACCCTCCCTGCCGGCCGTCGAGGCCGTCGCGAGCCAGCCGAGCGACGTCGAC
GAGGCGGTAACCGAGGCGCGGGACGAGCACTTCGAGAGCCGGGCGTTCGTGCGCAACGCCCGCGAGCGGTATGCCGCCGTCCAGGACCTCAAAGCGCAGG
GCCTGGGCATCAAGCCGATCATGCGGGAGCTGGGGCTGGCGAAGGAAACGGTCCGCAAGTACTACCGCGCGGCCACCATCGAGGACGTCCTGGCCAAGAC
CCGCGACGGACGCGGCTCGGTCCTACGGCGGTGGGAGCCCTACCTCAACGAGCGGGTGAATGCTGGGATCACCAATGGCAGCCAGCTGTTTCGGGAGATC
CGCGAGCAGGGCTACCCCGGAAGCCAGGCCACCGTCCTGGCTTACCTCCGCCTGCTGCGCACCGCCGGCAGCACCGCACCCGCAGCGTCGCCGGCGCCGA
AGGTCCGCACCGTGACCCGGTGGGTCCTCACCGATCCCGAACACCTCGACGAGGAGGAAACCCTCGCGTTGAAGAAGGTTCTCACCCGCTGCCAGCACCT
GCAGACCCTCGCGGGCCATGTCACCGCGTTCGCGCAGATGCTCACCGGACGCCACGGCGACCGGCTCAACACCTGGATCGCCGCCGTCGACGCCGACGAC
CTCCCTGAACTGCACCGTTTCACCCGCGGCCTGCTCCGCGACCACGACGCCGTCCTCAACGGACTGACCCTGCCGCACAGCTCCGGACAAGTTGAAGGCA
CCGTGAACCGCATCAAAATGATCAAACGTCAGATGTACGGCAGAGCGAACTTCGACCTCCTCCGCAAACGCGTCCTGCTCGCGACCTGACCGCCGCCCGG
GTCCACTTCGATCACAAGATCAGGGCCAGATC
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
1461 bp486 aa2291689+No
ORF function : Transposase
Chemistry : Unknow

ORF sequence :

MHGRYRRRLVDAAIGGTHVEIDLLVRRFRCLDSGCSRVTFAEQVVGLTSPHARFTPLATGMIEAIGLALAGRAGSRLAGRVGLCAGRNTVLRRVRALPDP
QVGVVATLGVDDFAVRRGRVYGTVLVDLDRHRPVDLLADREAATFAGWLAEHPGAQVICRDRAGAYADGARTGAPDAVEVADRWHLWHNLAGHVEATVAR
HRSCLKEPSLPAVEAVASQPSDVDEAVTEARDEHFESRAFVRNARERYAAVQDLKAQGLGIKPIMRELGLAKETVRKYYRAATIEDVLAKTRDGRGSVLR
RWEPYLNERVNAGITNGSQLFREIREQGYPGSQATVLAYLRLLRTAGSTAPAASPAPKVRTVTRWVLTDPEHLDEEETLALKKVLTRCQHLQTLAGHVTA
FAQMLTGRHGDRLNTWIAAVDADDLPELHRFTRGLLRDHDAVLNGLTLPHSSGQVEGTVNRIKMIKRQMYGRANFDLLRKRVLLAT

 

Blast result :
Comments
ISFsp1 is 51% aa similar to IS469.
References
1] US DOE Joint Genome Institute