ISHma2

  • Family IS630
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
NC_006396 ND Haloarcula marismortui
Haloarcula marismortui ATCC 43049
DNA section
IS Length : 1153 bp

Ends


IR Length : 16/22

IRL : GTGGTTAGGGGAAGTTATGGAGGTAGCATCTGATATGAGAGTATGTCTGG
IRR : GTACCTAGCGTAACTTCTGGAGATGCCCGCCAAGATACTCCTCAATCCAC

Insertion site


Left flankDirect repeatRight flankDR Length
NNNNNNNNNNTANNNNNNNNNN2

DNA sequence

GTGGTTAGGGGAAGTTATGGAGGTAGCATCTGATATGAGAGTATGTCTGGAGAGCGCCGCAAAGAGATCGTCCGTCACCTCAGTGAGGACGATCTCGACC
GACTCCTTGCGGAATCTACTGATGAGAAACTCACTGAGCGGTTGATCTTTATCAAACGGATCTACAAGGGAGCAACTCTGGAGGACGCTGCCGACGATGT
CGGCAGGTCCTCTGGAACGGGAACACGCTGGGCTCGCCGGTGGAACAAGGGTGGCCTCGGTCTTCTGATGCCGAACTTCGGGGGCGGCAAGCCCCCGAAG
CTCGGCGAGGACCAACGCCAACGCCTCTTGGACCTACTTCGTGACGGGCAACCGTGGAAGAAACAAGAAATACAGCACCTCATTAACGAAGAATTCGACG
TAGAGTTTCACCCGGTCTACTTAAGCACCTTCCTCGAAAATCTCAGTCTTTCCTACGCAATTCCGCGAACTAAGCGCCCATCACGCCCGGAAAACGCCGA
AGAGATTCTCGACGAACGCGTCGGCGACGCGTTCGACGATGAGCCTGACGACATTCCCCACAACAAATGCGAGGGAGATGACGAGGAAGGCTGGGTTGTT
GACGAAGAAATCCGTACGGACGGTGGAACCGTCCTTGGATTTCTCGATACATCGCATCCACAACCGTGGGACAACTCCCAGCGACTCTACACCGTAGATG
ATCCGCATATCACCCGACCGCTGGTGAAGTTAGACGAACCAGCGGTCGGGTTCTATGCCCTCTCTGGTGAGAGTGTCGTTCAGTTTCCCGCCAATCAAGA
GAAAGAACGGATCTGCGAGTGTCTTGAGGGGATCCGCGAGCAGAATCCGGGTCAGCGGATTCTGCTCGTCCCAGACAACTTCTCCTCGCACGTGTGCGAG
TACACGCGTAGACGAGCCCATCAACTCGGTATCGATCTCGTCTTTCTCCCGGTTGGCTCTCCAGATCTCAACCCAATCGAGCAGGTCTGGAAGAGCCTCA
AATGGGAAGCATCACCGTTGATTGTGGAGAGCGCGGCAGAATACCGCGCTCTCCTCACTCAACTCTTTGAGCAACTGACGACTCAACTGAGCTTCGCGGC
CTCGTGGATTGAGGAGTATCTTGGCGGGCATCTCCAGAAGTTACGCTAGGTAC
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
1104 bp368 aa431146+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MSGERRKEIVRHLSEDDLDRLLAESTDEKLTERLIFIKRIYKGATLEDAADDVGRSSGTGTRWARRWNKGGLGLLMPNFGGGKPPKLGEDQRQRLLDLLR
DGQPWKKQEIQHLINEEFDVEFHPVYLSTFLENLSLSYAIPRTKRPSRPENAEEILDERVGDAFDDEPDDIPHNKCEGDDEEGWVVDEEIRTDGGTVLGF
LDTSHPQPWDNSQRLYTVDDPHITRPLVKLDEPAVGFYALSGESVVQFPANQEKERICECLEGIREQNPGQRILLVPDNFSSHVCEYTRRRAHQLGIDLV
FLPVGSPDLNPIEQVWKSLKWEASPLIVESAAEYRALLTQLFEQLTTQLSFAASWIEEYLGGHLQKLR

 

Blast result :
Comments
ISHma2 is 59% aa similar to ISA1083
References
1] Baliga,N.S., Bonneau,R., Facciotti,M.T., Pan,M., Glusman,G., Deutsch,E.W., Shannon,P., Chiu,Y., Weng,R.S., Gan,R.R., Hung,P., Date,S.V., Marcotte,E., Hood,L. and Ng,W.V. (2004) Genome Res. 14 (11), 2221-2234