ISFac5

  • Family IS481
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
NZ_AABC04000045 ND Ferroplasma acidarmanus
Ferroplasma acidarmanus Fer1
DNA section
IS Length : 972 bp

Ends


IR Length : 23/27

IRL : TGTCCCGTAAATATTTCCTATATATACCCTCTAAAAATATAATAAAAGAA
IRR : TGTCCCATTATTATTTCCTTTATATACTGTATGAATTTATATTTTTTCAT

Insertion site


Left flankDirect repeatRight flankDR Length
TGAATTTTTTCATTCTGCTGTTATATATATGTACAGTTGGAAAATTGAAATTTAAATCATTTATAA0

DNA sequence

TGTCCCGTAAATATTTCCTATATATACCCTCTAAAAATATAATAAAAGAATATAAGCCCAGAATGAAGTTAAATGAGAAAAAAATAAAATATATAATAAG
GGAGAAAAATAAGAGAAGATCATCTACAGAAATAGCTAAGGAAATGAAAATAACAACAAGGTATGTAAATTACATATACAAAAAATACAGGGATAATGGA
GAATATACAATAGGTAAAAGGAAACATAGGGAATTAAACAGCAAGGATATAGAAATAGTTAAAAAAATAAGATATGAATACCCTATGTCAGGACCTGAAA
GAATAAGGAAATACCTTAAAAGAAAGGGGATAATAATAGCTAAAAACAATATATACAGAATACTGTTATTATTAAATATGGTTGATAACAGCAATAATAA
GAAGAAACAGAGAAAATATATAAAATATGAGAGGAAACATAGCAACTCACTATGGCATATGGACTGGACTAAATACAGTGACAGTGAGAAGTTAATAATA
ATAGAAGATGATGCTTCAAGGTTCATAGTAGGAATGGGAATATACGGTGAGGAAACAATAGATAATACAATAGAAGCACTGGAAATAGCAATAAACACTT
ACGGTAAGCCTGAAGAGATATTAACAGACCATGGAACACAGTTCTTTTCAAATGGTAAGAATGGAATACCTGGAGATCACAATAAGTTCCAGGAATACTT
AGATAACAGTAATATAAAACACATACTTGGAAGGGTAAAACACCCTGAAACAAATGGAAAACTGGAGAGATTAAACTATACCATAAAACGTTTAAGGCCA
TATTTCAGTACCTGGGAAGAGGTAGTATACCATTACAACTATGAAAGGATGCATGACTCACTGTCAGATGGTGATAATATAGTTACACCAGCAATGGCAT
ATAAAAATAAAATGGTGGTAAAATGAAAAAATATAAATTCATACAGTATATAAAGGAAATAATAATGGGACA
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
864 bp287 aa63926+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MKLNEKKIKYIIREKNKRRSSTEIAKEMKITTRYVNYIYKKYRDNGEYTIGKRKHRELNSKDIEIVKKIRYEYPMSGPERIRKYLKRKGIIIAKNNIYRI
LLLLNMVDNSNNKKKQRKYIKYERKHSNSLWHMDWTKYSDSEKLIIIEDDASRFIVGMGIYGEETIDNTIEALEIAINTYGKPEEILTDHGTQFFSNGKN
GIPGDHNKFQEYLDNSNIKHILGRVKHPETNGKLERLNYTIKRLRPYFSTWEEVVYHYNYERMHDSLSDGDNIVTPAMAYKNKMVVK

 

Blast result :
Comments
ISFac5 is 61% aa similar to ISA0963-6.
References
1] Copeland,A., Lucas,S., Lapidus,A., Barry,K., Detter,C., Glavina,T., Hammon,N., Israni,S., Pitluck,S. and Richardson,P. (2005) Direct submission GenBank