ISFac8

  • Family IS256
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
NZ_AABC04000026 ND Ferroplasma acidarmanus
Ferroplasma acidarmanus Fer1
DNA section
IS Length : 1291 bp

Ends


IR Length : 23/31

IRL : GGTTGTGTATGTAATTTTGTGTAAATATAAACCCCCCTGTTATCAATGAA
IRR : GATTGTGTCCAGAATTCTGTGTATTTATAAAGGATACCGCTTCTGAAACA

Insertion site


Left flankDirect repeatRight flankDR Length

DNA sequence

GGTTGTGTATGTAATTTTGTGTAAATATAAACCCCCCTGTTATCAATGAATTTAATCATTAAATAACAGGAAAGGATACCTCTTTTGAGCAGAGAGGTAA
CAAAATATGGAAAATACAGATATAAACATATCGGCTCTTTTGAATGTAGATATAGATAAAATACTCAAGCAAACAATAAAGGAGAAAATAGAGAAATTAA
TGGAAATAGAGTTAAATGCATATTTAGAGGAAAATCCAGGAATAAAGAATGGGAAATACAAAAGGGATTTAAAGACAAAGTATGGTGAAATAAAACAATT
AAATGTTCCCAGAGACAGGGATAGCAATTTCCATACACAGGTAATAGAACCATATAACAGATCAATAGGAATGGAAGATCTTATAGTATCAATGTATTCC
AATGGAATATCTACAAGGAGAATAGCAGGTATAATGGAGGATATTTTAGGGAATAAATATTCTAAATCTACTATATCCAGAATAACAGATTTAACCATAG
AAGAGGTTTATAAATTTATTAACAGGCCATTGGACAAAAGGTATATAGCAGTATTCTTAGATGGATTATTCTTCTATTTAAGAAGGGGAAATGTAGATAA
AGAGCCTGTTATATTTGCATTAGGAATAAAAGAAACAGGAGAGTATGAAGTATTAGGGTTCTATTTAACAGTTAAAGAATCACATAATGCATACAAGGAA
GTACTTGAAGATCTGTATAATAGAGGATTAAAGGAGCCATTGTTAATTGTAGCAGATGGAATAAAGAATTTAGATGAGGAAGTAATGGAAATATATCCCC
GATCAGAATTCCAATTGTGTACAATACACTATGCAAGGGGATTAAAATCCAATGTAAGGGAGAAAGATATTGATGAAATAACAATAGATGCGAATAAGAT
GTTTAAATGTGATAATAAGGAAGAAGCTATAATAAGATTTAATGATTTTAAATACAAATGGAAGAGTAAGTATCCTAAAGTTATATACAATACTGAAAAG
AATCTAGGTAAATTATTAAGATTCTATAATTATCCTGTAAATATAAGGAAATCATTGAAATCTACCAATGCCATAGAGAGATTTAACGGAGAAGTAAGGA
GAAGGGTAAAAACAATATCATCATTCCCTGATGAAGATTCAGCAATGAAGGTATTCTATTATAAGTCAATAGAATACAATTCAAAGCATGCATTCAGGAA
GATGAACGGATACTATAAATGCAAGGATGAAATAAAGGAAATGTTTCAGAAGCGGTATCCTTTATAAATACACAGAATTCTGGACACAATC
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
1161 bp386 aa1071267+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MENTDINISALLNVDIDKILKQTIKEKIEKLMEIELNAYLEENPGIKNGKYKRDLKTKYGEIKQLNVPRDRDSNFHTQVIEPYNRSIGMEDLIVSMYSNG
ISTRRIAGIMEDILGNKYSKSTISRITDLTIEEVYKFINRPLDKRYIAVFLDGLFFYLRRGNVDKEPVIFALGIKETGEYEVLGFYLTVKESHNAYKEVL
EDLYNRGLKEPLLIVADGIKNLDEEVMEIYPRSEFQLCTIHYARGLKSNVREKDIDEITIDANKMFKCDNKEEAIIRFNDFKYKWKSKYPKVIYNTEKNL
GKLLRFYNYPVNIRKSLKSTNAIERFNGEVRRRVKTISSFPDEDSAMKVFYYKSIEYNSKHAFRKMNGYYKCKDEIKEMFQKRYPL

 

Blast result :
Comments
ISFac8 is 64ù aa similar to IS654.
References
1] Copeland,A., Lucas,S., Lapidus,A., Barry,K., Detter,C., Glavina,T., Hammon,N., Israni,S., Pitluck,S. and Richardson,P. (2003) Direct submission GenBank