ISHma12

  • Family IS200/IS605
  • Group IS605
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
NC_006393 ND Haloarcula marismortui
Haloarcula marismortui plasmid pNG500
DNA section
IS Length : 1835 bp

Ends


Left end : CTGAAAGTAGGCGCTAAGCCCCCTTCCTCAGCGAGCGCCGACCGAACGGGAGGCGCGAGCAGGGAGGGGATACAGCGCCGCACAGTTCTCATACACGATT II struct. : Yes
Right end : GGATACGCCTGTATCTGCAAAGCGCGTCGTGGAAGCAGGAAGCCCTACCCTCAAGGAGCGAACGGCGTCAGCCGTGAGCGAGTAGGGTAGGGTAGTTCAC II struct. : Yes

Insertion site


Left flankLE cleavage siteRight flankRE cleavage site
GTTCACAGAAGATTTAGATAGGGACGATCAC

DNA sequence

CTGAAAGTAGGCGCTAAGCCCCCTTCCTCAGCGAGCGCCGACCGAACGGGAGGCGCGAGCAGGGAGGGGATACAGCGCCGCACAGTTCTCATACACGATT
CGGTGGCAGGCTCACAGGCCCACGCAGTCGCAATTTTTTTGCAGTAGGGTAGCATAGTATTAACCGAACCCAATGGGGTACGACCTCGACTCGGGAGCAC
ACTCGACGTATTCCCTGCACTACCACCTGATACTCACCACGAAGTATCGGCGTGGCGTGCTAACCGAAGAGCGAACCCAATTCATTCACGAGGTTATCAG
CGGGTTCACGGACAACTACGGCGTCGAACTGACGAACCTCGACGGCGAGGACGACCACGTACACATCCTATTCCGAGCGAAACCAACCACAGACCTCGTG
AAGTTCATCAACACGGTCAAGGGCGCGACCGCCCGCCGTATCCGAAACGAGTACGCGGATGAACTGAAGACCGAACTGTGGGGCGACTCGTTCTGGAACG
ATTCGTACTGCCTCATCTCGACGGGGCAGGTGTCGCTGGATGTGCTGAAACAGTACGTAGAGGACCAACGCGAGTAGAATGTACTACGCCTACAAGTACC
GTCTCAATCCGTCCGACGCCCACCGTGATGAGTTGGACCGCCACCGAGACATTTGTAGGCAACTGTACAACCACACGCTCTACCGTCTCAACGAGTACCA
AGACGAACACGGCGAACTGCCGTCCATGACCACGCTACGGTCGGAGCTACCCGACCTCAAGAAGTGGTGGGACGGCCTCTCCGACGTGTACTCGAAGGTT
CTCCAAACCGTCGTGGAACGCCTGTTCGACAACCTCAAAGGTCTCTCCAAACTCAAGGAGAACGGCTACGGCGTCGGTCAACTCAAGTGGAAGCCGCCAC
GCGAGTTCCGCAGTCTCACGTACAGTCAGTCTGGCTTCAAGCTCGACAAGAAGGGCGGTCAGACTGTCCTGTCACTCTCGAAACTCGCGGACATACCGAT
TCGGCTCCACCGAGCCATCCCCGACGACGCAAAGCCCAAGCAGGTCACGCTCAAGAAGGAACCGACGGGCGAGTGGTTCGCCACCTTCGGCGTCCAAATG
GACCGTGAACCGCCCCAACCGCCTGAGAACCCCGAGAAGTGCGTCGGTATCGACGTGGGCATACTCAAGTACGCCCACGACACCGACGGCACGGCGGTCG
GGTCGCTCGACTTGTCCGACGAACGCAAGCGGTTGGAACGCGAGCAACGGAAGCTCTCGCGCAAACAGCACGGGTCGAACAACTACGAGAAGCAACGGCG
TCGAGTCGCGGAGTGTCACGCCGACCTCCGACGGAAGCGCCGCGACTTCTTGCACAAGCTCTCGGCGTACTACGCTCGGGAGTACGACCTTGTGGCGGTC
GAAGACCTGAACGTGAAGGGGATGATGGAGTCGCCGTCGAACAGCCGCAACACGGCGTCTGCCGCGTGGCGAACGTTCCTCTCGTTAGTCGAATACAAGT
GCGAACGTGAAGGAACGCACTTCATCGCGGTCAACCCGGGAGGGACGACCAAGGAGTGCGCGTCGTGTGGCGTTTCGACCGACAAGCCGTTGTGGGTCCG
TGAACACTCCTGTCCCGCCTGCGGGTTTGAGGCGGACAGGGACTCGAACGCGGCGTGGAACATTCTTTCTCGCGGCCTCGAAGACGTAGGAGTGGGATAC
TCCGAATCAACGCCTGTGGAGACTGCGCTCCCTGTGGATACGCCTGTATCTGCAAAGCGCGTCGTGGAAGCAGGAAGCCCTACCCTCAAGGAGCGAACGG
CGTCAGCCGTGAGCGAGTAGGGTAGGGTAGTTCAC
Protein section
ORF number : 2

 

ORF 1
LengthBeginEndStrandFusion ORF
405 bp134 aa173577+No
ORF function : Transposase
Chemistry : Y1

ORF sequence :

MGYDLDSGAHSTYSLHYHLILTTKYRRGVLTEERTQFIHEVISGFTDNYGVELTNLDGEDDHVHILFRAKPTTDLVKFINTVKGATARRIRNEYADELKT
ELWGDSFWNDSYCLISTGQVSLDVLKQYVEDQRE

 

Blast result :
ORF 2
LengthBeginEndStrandFusion ORF
1242 bp413 aa5791820+No
ORF function : Accessory Gene
AG : TnpB

ORF sequence :

MYYAYKYRLNPSDAHRDELDRHRDICRQLYNHTLYRLNEYQDEHGELPSMTTLRSELPDLKKWWDGLSDVYSKVLQTVVERLFDNLKGLSKLKENGYGVG
QLKWKPPREFRSLTYSQSGFKLDKKGGQTVLSLSKLADIPIRLHRAIPDDAKPKQVTLKKEPTGEWFATFGVQMDREPPQPPENPEKCVGIDVGILKYAH
DTDGTAVGSLDLSDERKRLEREQRKLSRKQHGSNNYEKQRRRVAECHADLRRKRRDFLHKLSAYYAREYDLVAVEDLNVKGMMESPSNSRNTASAAWRTF
LSLVEYKCEREGTHFIAVNPGGTTKECASCGVSTDKPLWVREHSCPACGFEADRDSNAAWNILSRGLEDVGVGYSESTPVETALPVDTPVSAKRVVEAGS
PTLKERTASAVSE

 

Blast result :
Comments
ISHma12 is 68%(ORF A) aa similar to ISH1-8 and 49% (ORF B) to ISSs1.
References
1] Baliga,N.S., Bonneau,R., Facciotti,M.T., Pan,M., Glusman,G., Deutsch,E.W., Shannon,P., Chiu,Y., Weng,R.S., Gan,R.R., Hung,P., Date,S.V., Marcotte,E., Hood,L. and Ng,W.V. (2004) Genome Res. 14 (11), 2221-2234