ISPosp3

  • Family IS1595
  • Group ISSod11
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
NC_007948 ND Polaromonas sp.
Polaromonas sp. JS666
DNA section
IS Length : 1050 bp

Ends


IR Length : 24/26

IRL : AGGGGTATCCGCTTAGCTCCAGTGGAGTCGGATATACTGGATAAATACCC
IRR : AGGGGTATCCGCTTAGCTCCACTAGACCGATTCCACCATGTCCTGTGTTG

Insertion site


Left flankDirect repeatRight flankDR Length
GTCGGATAAATACTGTATTTATGTACAGTATATTGAATACTC10
AAAGTAACTGTATGAATATACAGCCATACT10

DNA sequence

AGGGGTATCCGCTTAGCTCCAGTGGAGTCGGATATACTGGATAAATACCCAGTTATTATGCCAGTTCCAGCCCAAGACTACCCCCGCACCTGGAGCGAAT
TCCTCGATTGGTTTTCCTCCGAGGAGGCTTGCCTGTCTTACCTGGAGCGCTTGCGCTGGCCGCACGGCTTCGCCTGCCCAAATTGCGCCAGCATGGCGGC
GCCATACCGATCCAGCCGCACGCGATTGATGTGCCAGGACTGTGGGCGACAGACGACCGTGACCTCGGGCACCATCTTTGACAAGACCCGTACGCCGCTA
AAGGTATGGCTGGCGGCGGCGTGGTATCTCACCAGCCAGAAGCAAGGTGTCAGCGCCCTAGGCTTGCAGCGGGTGTTGGGGCTGGGCAGCTACCAGACGG
CCTGGACCATGCTGCACCGCTTTCGCTGTGCCATGGTGCGCCCGGATCGGGAACGCCTGAAAGGTCTGGTCGAGGTGGATGAAACCTACCTGGCCATCTC
GGACCGACAGCAGCCCATCTCTGCCGTGGGTCGCAAGAGCCGCACCAGCAAAGTACTGGTGGTGATGGCCGTGGAGATACTGCAGCCCAAAGGATTTGGC
CGGATTCGTCTGCACCGCATCGCCAATGATTCTGACGAATGCGTGGTGCCGTTTGTCCAGCAGTCGGTGGAGCCCGGCGCCCAGATTCGCACTGACGGCT
CGGCCGCCTATCGTTCGCTCAGCGAGCTGGGCTATGACCATGAGCGCACGGTCATGCTGGGCTCGGATGTTCCTGCCCATGTCTCCATGGCAGGGGTGCA
TCGGGTGGCCTCACTGGTCAAGCGCTGGATCCTGGGCACGCACCATGGCTCGGTCCAGCCCGAGCATCTGGATGCCTACCTGGATGAGTTTGTCTTTCGC
TTCAATCGCCGCACTTCGGGCTCTCGCGGGATGCTGTTTTACCGGCTGCTGCAGCAAGCCGTTGTCACGAAACCCGTGACCTATCAGGACATCACCCGAA
CAACACAGGACATGGTGGAATCGGTCTAGTGGAGCTAAGCGGATACCCCT
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
972 bp345 aa581029+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MNIRGIRLAPVESDILDKYPVIMPVPAQDYPRTWSEFLDWFSSEEACLSYLERLRWPHGFACPNCASMAAPYRSSRTRLMCQDCGRQTTVTSGTIFDKTR
TPLKVWLAAAWYLTSQKQGVSALGLQRVLGLGSYQTAWTMLHRFRCAMVRPDRERLKGLVEVDETYLAISDRQQPISAVGRKSRTSKVLVVMAVEILQPK
GFGRIRLHRIANDSDECVVPFVQQSVEPGAQIRTDGSAAYRSLSELGYDHERTVMLGSDVPAHVSMAGVHRVASLVKRWILGTHHGSVQPEHLDAYLDEF
VFRFNRRTSGSRGMLFYRLLQQAVVTKPVTYQDITRTTQDMVESV

 

Blast result :
Comments
ISPosp3 is 48% aa similar to ISXo2.
References
1] Copeland,A., Lucas,S., Lapidus,A., Barry,K., Detter,J.C., Glavina del Rio,T., Hammon,N., Israni,S., Dalin,E., Tice,H., Pitluck,S., Brettin,T., Bruce,D., Han,C., Tapia,R., Munk,A.C., Gilna,P., Schmutz,J., Larimer,F., Land,M., Hauser,L., Kyrpides,N., Anderson,I. and Richardson,P. (2006) Direct submission Genbank.