ISPme1

  • Family IS1380
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
EF585233 Y Paracoccus methylutens
Paracoccus methylutens DM12
DNA section
IS Length : 1671 bp

Ends


IR Length : 14/16

IRL : CCCACATTCTCCAAGTAAGTCGCTGATTTCGCTGTCGTAATCGTGATATT
IRR : CCGACATTCCCCAAGTGGCCCGCCGCTTGACTTCAAGATCGCCTGATTTT

Insertion site


Left flankDirect repeatRight flankDR Length
CTGAAAGATTATGCAATGCGCTTTG5

DNA sequence

CCCACATTCTCCAAGTAAGTCGCTGATTTCGCTGTCGTAATCGTGATATTTCGCATATAAATCATGGCGTTGACGGCTGCGAGGGGCGCGTTTCATGGAT
CACCTGGAGGGTGCGGGCTTGGCGCGGGGAGATCGGGTTGATTTCGACCGCCGTGTGCGTCTGGAGTTCCGTGGTGCGCAGATCAGTTCAGACGGTGGCC
TGCTGGTGATGCGCGAGCTTGATGACGTGCTCGGCCTGTCCAATCTGGCGTCGGAGGCGCTGCGAGACAGCCGCACCGGGAAGAACACGCTCCATCGGCT
TGACGGATTGTTCCGGCAATCGGTGTTCGGACGACTGGCCGGATACGAGGATGTGAACGATGCCGACCGCTTGGCCCTCGATCCCGTGATGCGTCAGGTC
GTTGGCGGCAGGGCCGTCGAGGCGCAAGCTGCTTCGGCATCGCAGATGGGACGGTTCGAGACCGAGACGCTGGCTCTGGCCGCGAACCGGGCGGCGCTGG
CCGATCTGAACGGCCAATGGATCGACCGGTTTCATGACCGCAACGGGTTGAAATACATCGTGCTGGACATGGACAGCTCGGTCAGCCCCACCCACGGCGA
TCAGGAAGGTACTGCCTGGAACGGGCATTTCGACTGCACCTGCTATCACCCCATCTTCTTGTTCAACCAGTTTGGCATGCTGGAGCGCTGCGCCCTGCGT
AACGGCAATGTCCACAGCGCCGATGGCTGGCGGGATGTCCTTGATCCCGTCATTGCCCGATATGCTGGCCGCGACCTTGGTGGACGCTTCTTCCGGGCCG
ACGCTGCCTACGCGATCCCCGCGATCTATATGCGGCTGGAAGAAGCCAGGTTCTTCTACGCCATCCGTCTGCCCGCCAACGCCGTCTTGCGCGAGAAGAT
CGCGCATCGGCTGACACGGCCCGTGGGACGGCCTTCGCTGACCAAGGTCAAACGGTTCTTCGAGGACTTCGAGTATCAGGCGGCGTCCTGGGACAAGCCG
CGCCGCGTCATCGCCAAGATCGAATGGCATCCGGGCGAGCTGTTCCCCAAAGTCGGCTTCATCGTCACCAACCTGCCGATGGAGCCAGACTGGGTGGTGA
GGTTCTACAACCAGCGCGGCACCGCAGAGCAGCACATCAAGGAAGGCAAATATGCCTTTCGCTGGACGCGGCTGTCATGCCGGAAGTTCCGGCACAACGA
GGTGCGGCTGCAACTGCACGCGCTGGCCTACAACCTGGCAACCTTCCTGCGCTGCATCGAACTGCCCGAGGCCATGGCGGACTGGTCGTTGACCAGCCTG
CAACTCAAGCTGATCAAGATCGGCGCCCGCGTCGTCCGCCACGCCCGCGCCATTACCTTCCAGTTGGCCGAGGTCGCCGTCACCGGCCCGATGGTGCGGG
CCGTCCTTGCCGCCATCCGCCGTCTTCGAACGCCTCCGTCATGCGCATGACCACGATCCATGCCCAAGCTGAACGAAAGCGGCAGGACAGGTCCGTCTGC
CGCGCGGAAAAGCGGCTCTGCCGGGCCAGAATGCTGCGGGTTCGAGGCTTGATCCACCCGACTTCGGCCGTTTGCGCGACGACAGACACCGCTCGGGGCG
AAAAACGCTTGCCCAGCGAGCAAAATCAGGCGATCTTGAAGTCAAGCGGCGGGCCACTTGGGGAATGTCGG
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
1356 bp451 aa951450+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MDHLEGAGLARGDRVDFDRRVRLEFRGAQISSDGGLLVMRELDDVLGLSNLASEALRDSRTGKNTLHRLDGLFRQSVFGRLAGYEDVNDADRLALDPVMR
QVVGGRAVEAQAASASQMGRFETETLALAANRAALADLNGQWIDRFHDRNGLKYIVLDMDSSVSPTHGDQEGTAWNGHFDCTCYHPIFLFNQFGMLERCA
LRNGNVHSADGWRDVLDPVIARYAGRDLGGRFFRADAAYAIPAIYMRLEEARFFYAIRLPANAVLREKIAHRLTRPVGRPSLTKVKRFFEDFEYQAASWD
KPRRVIAKIEWHPGELFPKVGFIVTNLPMEPDWVVRFYNQRGTAEQHIKEGKYAFRWTRLSCRKFRHNEVRLQLHALAYNLATFLRCIELPEAMADWSLT
SLQLKLIKIGARVVRHARAITFQLAEVAVTGPMVRAVLAAIRRLRTPPSCA

 

Blast result :
Comments
ISPme1 is 96% aa similar to IS1247.
ISPme1 has been identified by its transposition to entrapment vector pMEC1. It is present in multiple copies in P. methylutens DM12 genome (within chromosom and plasmids pMTH1 and pMTH4).
It has been demonstrated that a single copy of insertion sequence ISPme1 can mobilize adjacent segments of genomic DNA of Paracoccus methylutens DM12, which leads to the generation of diverse transposable elements of various size and DNA content. All elements (named transposable modules; TMos) contain ISPme1 (placed at the 5’ end of the elements) and have variable 3’-end regions of between 0.5 - 5 kb.
ISPme1 was shown to encode an outwardly oriented promoter, which may activate transcription of genes transposed within TMos in evolutionarily distinct hosts.
Sequence analysis of plasmid pMTH1 (32 kb) revealed that four TMos, previously identified with a trap vector pMEC1, comprise 87 % of its genome.
References
1] D. Bartosik (2006) Direct submission
2] Bartosik, D., M. Putyrski, L. Dziewit, E. Malewska, M. Szymanik, E. Jagiello, J. Lukasik and J. Baj.(2008). J Bacteriol 190: 3306-3313.
3] Dziewit, L., Baj, J., Szuplewska, M., Maj A., Tabin, M., Czyzkowska, A., Skrzypczyk, G., Adamczuk, M., Sitarek, T., Stawinski, P., Tudek, A., Wanasz, K., Wardal, E., Piechucka, E., Bartosik, D. (2012) PLoS ONE 7: e32277