ISPepr4

  • Family IS4
  • Group ISPepr1
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
ND Pelobacter propionicus
Pelobacter propionicus DSM 2379
DNA section
IS Length : 1562 bp

Ends


IR Length : 17/19

IRL : CTCAACTTTCGCAGTTGGCATAAAAGCGTAACCTGCTGTAATTATAAATA
IRR : CTCAACTTTCGCAGCAGGCTATTTGTTAGTAACCGCCTGAGATGCTGTCG

Insertion site


Left flankDirect repeatRight flankDR Length
GGTGAAGAGGTTTATTGATAAGGTACAG8

DNA sequence

CTCAACTTTCGCAGTTGGCATAAAAGCGTAACCTGCTGTAATTATAAATAGAATAGCGTCGCAATCTGTATTAATATGGCTTTGCTCCCCAGCAAATCCA
ATAACGCAGAAAGGCGACGCTATGAACCGGATTTTACCAGAGATCGCAACAGTTGAGAACCAGATAAACCTGTTCTTTCACAATCATAAACTTGGCGAAC
TTCTTCGACAAAGCAACGTCAGAAAAGATAAGGGCGTTTCTCTGGACATTCTGTTCCAGTTTTTGCTGACAATGGCCTTTACCGGAAAGAACCTGTTTCG
CTTGTTGAACACGCCTGATACTCCTGACATACCGCCAGGCATCAGTAAAGACGTTGTCTATCGTTTTTTGAACTGCATCTCTTCCAACTGGCGCAAGTTT
CTGTTTCTGCTCAGCACCAGAGTCATACTCCAGAAACTTTTACCGTTGACGGACGATGCCACCACCAAGGTACTGATTGCCGACGACACCCTGTATCTCC
GTGATCGCAGCAAATGCGTGGAGCTTTTGGCCCGGGTCCATGACCACAACACCAAGAGATATCACCGGGGCTTCAGAATGCTCACCCTGGGGTGGTCGGA
TGGCAACAGTTTCGTGCCCATGCTCTTCTCCATGCTGAGCTCCTCGAAGGAAAAGAACCGCCTTGCCGCAATGCGCACTGACCTCGACAAGCGCACCAAT
GGCTACAAGCGCCGGCAGGAAAGCGTGAATAAATCTCCGGATGTGCTGGTGGAACTGGTAAAGGTGGCCATGGCCGCCGGCTCCAAGGCGCGCTATCTGC
TGTTTGACAGTTGGTTTGCCTTTCCCGTCACCATCAGGCGTATCCATGCTTTGGGAATGCACACCATCTGCATGCTCAAGGACTCGAAAACCCGCTATAC
CTTCCAGGGAGATGGCATGCCCCTGAAGGAATTGTTTAAATGGGTCCGCAAGCGGCCGGGACGGGCCAAGGTCCTGGCTTCTGTCATGGTGACCATTGGC
GAGGATGACAAGGGCAATCCTGTTGCGGCAAAGATCGTGTTCGTACGAGACAGAAGCAAAAAGAGCTGGCTTGCACTTCTTTCAACCGACACCACGTTGG
CGGACGAAGAGATCATCAAGCTCTACGGGCGGCGCTGGGATATCGAGGTGTTCTTCAAGATGAGCAAGTCGTTTCTGAATCTGGCAAAAGAGTGTCAGGG
CCGCTCCTTCGATGCCTTGGTTGCCCATACGACGGTGGTGTTCTGCCGCTACATCATGCTGGAACTCGCCAGAAGAACGAATGCCGACCCGCGAACCCTC
GGAAACCTGTTCCATGCCACCTGCGATGAACTCAGGCAAACGAGCTTCGTCGAAGCGCTGGCATTACTACTGAAGTTGCTTGAACAGTCACTGAACAAAC
TTGCTGGATTTACCAAGGAACTGATGCTGCAACTGGTTGAGCAGTTTGTTGCACAACTGCCATTGCCTTTTAAGGCAAGGATGTTACTTTCTGCCTTGGC
AACCCAGTAAACCGACAGCATCTCAGGCGGTTACTAACAAATAGCCTGCTGCGAAAGTTGAG
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
1386 bp462 aa1221507+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MNRILPEIATVENQINLFFHNHKLGELLRQSNVRKDKGVSLDILFQFLLTMAFTGKNLFRLLNTPDTPDIPPGISKDVVYRFLNCISSNWRKFLFLLSTR
VILQKLLPLTDDATTKVLIADDTLYLRDRSKCVELLARVHDHNTKRYHRGFRMLTLGWSDGNSFVPMLFSMLSSSKEKNRLAAMRTDLDKRTNGYKRRQE
SVNKSPDVLVELVKVAMAAGSKARYLLFDSWFAFPVTIRRIHALGMHTICMLKDSKTRYTFQGDGMPLKELFKWVRKRPGRAKVLASVMVTIGEDDKGNP
VAAKIVFVRDRSKKSWLALLSTDTTLADEEIIKLYGRRWDIEVFFKMSKSFLNLAKECQGRSFDALVAHTTVVFCRYIMLELARRTNADPRTLGNLFHAT
CDELRQTSFVEALALLLKLLEQSLNKLAGFTKELMLQLVEQFVAQLPLPFKARMLLSALATQ

 

Blast result :
Comments
ISPepr4 is 83% aa similar to ISGur1. ISPepr4 was found by screening completely sequenced genomes for sequences homologous to the ISGur1 transposase using BLASTP. Multiple sequence alignments revealed a conserved DDE motif : D(N2)-106-D(N3)-112-E(C1). The sequencing of the Pelobacter propionicus DSM 2379 chromosome is currently in progress. Accession: NZ_AAJH00000000.
References
1] De Palmenaer D, Siguier P, Mahillon J (2008) BMC Evol Biol , 8(1):18
2] Copeland,A., Lucas,S., Lapidus,A., Barry,K., Detter,J.C., Glavina,T., Hammon,N., Israni,S., Pitluck,S. and Richardson,P. (2005) Unpublished