ISLre2

  • Family ISLre2
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
AP007281 Y Lactobacillus reuteri
Lactobacillus reuteri 100-23
Lactobacillus reuteri JCM 1112
Lactobacillus reuteri DSM 20016
Lactobacillus reuteri SD2112
Lactobacillus johnsonii DPC 6026
DNA section
IS Length : 1570 bp

Ends


IR Length : 18/25

IRL : GTTAGTGTAAGATTTTCATAGGTTGGATGAATAATTCATCTGGTCGTGGA
IRR : GTATCTGTCAAGTTTTCATAGGTAGCCTTTAAATATACAGTTTTAGTGGG

Insertion site


Left flankDirect repeatRight flankDR Length
CACCCACTTAGGAGTCCTATTCCTACTTC9
AAAATGTAAGGGCAACCATTCTGCTGTTG9
TTGATTCTAGTCTCCTATTTCTCCTATTT9
TTGATTCTAGTCTCCTATTTTAGTATTGG9
CACCCACTTAGGAGTCCTATTCCTACTTC9
AAAATGTAAGGGCAACCATGGCAACCATT9

DNA sequence

GTTAGTGTAAGATTTTCATAGGTTGGATGAATAATTCATCTGGTCGTGGAAATCTTTTTTGTAGACCAATTTACTTATTTACAAAAAAAGAAAAGACCAG
TAGCCTTTAGTGTGTCGAATACTAAGCAAAGGCAGGTCTTTCCTCATGGATATTTTAACAGAAATCGAGCAGAATTTGGTGAAATCAGGCAGTTTATTTG
AAGCTGAACAGATTATTTTAAAAGGGGTATTGGAGTTAGGACAAGTAATCATGCAAAACTTTTTGGAAAGCTTAGATCGAAGCTTAAAGTCCCAAGCTCC
AGCGAACTATCAAGTAATCAATAAACAGCCACGGACGCTTAATTTTATCTTTGGCCCGGTGACTTTTCAACGACGGTATTATCAGGCTGGGACAAAGAAA
CGTGAATTTTACTTAGACCAACAATTAAAAATTAAACCACGTCGTCGTTTATCGCCACACTACTTAATGATGATGGCTAAGATTGCCCAAACAACTACAA
TGCGCAATACTGCCGACATTTTGAACCTTGTATTTGACAGCGGAATTACTGCCGATTCGGTAATGCACGCCGTGCATGAGTTAGGAAATCAGGTAGCTAA
ACAAACTCAAGCAAAAGAACACCAAGCTACTCCTCGCCATATGCCTAAAAATTTAACTATTGAGGGTGATGCCTTTATGATTAAAGGTAAAAAAGAAGCA
GGTCAGCTGACTCTTGTGCACCATTATCGGGTTTATGAGCGAGTAGCTAATCAAATCATTAATCGGCATGACTTTCTCAGTGTTGGGCACCAAGGACGGC
TTGAAGCACGACTAAGTGATTATTTAGACCGCCATTATAAGCTTGCCGGTCAAACGATCTTTTTGGCCAGTGACGCTGGCCCAGGTTACGAACCAGCTAA
GCTATTAAGTCTAGTTCCTCAAGGTGCACATGGTGAATACTTTCTCGACCGCTATCATTGTTTACAGAAAATTGAACATACTTTAGGCCGGCACAACGAA
TTAGCCATGCGAGCAATTAAAGCCGTTCGTCATCATGATCAAGCAGAGCTAACAATAATTTTAGATACTTATGAATCACAAAACCTAACGGAAAAACAAG
CAGACGACCTAATGCGTTTAAGAAAGTATCTACAGCGAAATTGGCGGTATATCCTCTCACCACAAATGCGTGGATTTAAGGATATTCATTTAATTGGTTC
AGTCGAAAGTTCTCACCGGGCTTTTACTTACCGGATGAAGAAACAGGGCAAGTCATGGACTAAGCAGGGGGCTAAAGCCATGATTGGTTTAATTGAAGCC
CGAATGAATGGTGAACTGCAAGCTAGTTTAAATACAATCCTAGAACAATTAACAGTTCTTCCTCGAGTGGCTCAAACCAGCCTATTACAGGAAATGCATA
TTCGAACTGGAGAGTTTCTAAGAAAGGCACCGACAAAGCCGTCAATTGGAGTAGTACAAGGAATAATTCCGATTAATACGGCCACAAGTAGACCAATAGG
ACAACTTTTTAAGGCACTAACCCACTAAAACTGTATATTTAAAGGCTACCTATGAAAACTTGACAGATAC
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
1383 bp460 aa1461528+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MDILTEIEQNLVKSGSLFEAEQIILKGVLELGQVIMQNFLESLDRSLKSQAPANYQVINKQPRTLNFIFGPVTFQRRYYQAGTKKREFYLDQQLKIKPRR
RLSPHYLMMMAKIAQTTTMRNTADILNLVFDSGITADSVMHAVHELGNQVAKQTQAKEHQATPRHMPKNLTIEGDAFMIKGKKEAGQLTLVHHYRVYERV
ANQIINRHDFLSVGHQGRLEARLSDYLDRHYKLAGQTIFLASDAGPGYEPAKLLSLVPQGAHGEYFLDRYHCLQKIEHTLGRHNELAMRAIKAVRHHDQA
ELTIILDTYESQNLTEKQADDLMRLRKYLQRNWRYILSPQMRGFKDIHLIGSVESSHRAFTYRMKKQGKSWTKQGAKAMIGLIEARMNGELQASLNTILE
QLTVLPRVAQTSLLQEMHIRTGEFLRKAPTKPSIGVVQGIIPINTATSRPIGQLFKALTH

 

Blast result :
Comments
The transposase amino acid sequence is 29% similar to the transposase of the integrative and conjugative element (ICE) TnGBS1 of Streptococcus agalactiae NEM316 [1].
As for TnGBS element, ISLre2 is inserted 15 bp upstream the -35 box of typical sigmaA promoters. An extrachromosomal circular form of the IS have been amplified by PCR.
References
1] Brochet M, Da Cunha V, Couvé E, Rusniok C, Trieu-Cuot P, and Glaser P, P.(2009) Mol Microbiol. 71(4):948-59