ISLbu1

  • Family ISLre2
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
NC_013192 ND Leptotrichia buccalis
Leptotrichia buccalis DSM 1135
DNA section
IS Length : 1519 bp

Ends


IR Length : 22

IRL : GACAGAGTAAAAAAAAATAGGGGCAAATAAATTTAATTAAATTTCAAATT
IRR : GACAGAGTAAAAAAAATAGGGGCAGTCATTAAATACCACAACAAACTTTT

Insertion site


Left flankDirect repeatRight flankDR Length
AATATTAGTTTTTTTTTGTA0
TTTTCGTGTATCTTTTCGTG0
CAAATTACTGGAATATAAAAATTAATAATG10
AACTAATATTACAAAAAAAG0
CAAGATTTACAAAATTTACAAAAATCAAA9
CAAAAAATCATTTTCTTTTTT0
TAGTTTAATATTATTAAGTTA0

DNA sequence

GACAGAGTAAAAAAAAATAGGGGCAAATAAATTTAATTAAATTTCAAATTAACAAAAAAGAGGAAACCAGTTACAATATAATCGCCAATCCTATTGAAAG
GTGGTTTCCTCTATGATTAGAATATCAAATTTTTTTTCACTTGTAAAGACTTTTTTTAAAAATATTTTTTCCTTCAGACTTCCGTTTGAGCAGCAGTTTA
AGCTGTTTGTCACAAAAGCTTTTGAAATGCTGTTTAGAGTTTATGTCAAAAGAGTTGATGATCACTTCTTTCATTCCAACGAAAGAAAAGATAAGTTTAA
AAGCAAAGGATTTGTTAAAAGAACTGTTACTACTGCCTTCGGGGATGTAACTTTTGAACGTCGAAAATATGTAAACAAAAAAACAGGCATTCACTATTAC
ATTGATGAAAAAATTGGACTTAAGCGGTATAGACGGCTTTCTGAGGAGATGATTTTTACTATACTTTTTGAATATCAGTATACTACAGCTTCATTTCTTG
CAAAAACTTACGGTGTTTCAAGGGCTACCGTGTATAATCTTGTCAATTCTTTTCAAATGCCGAAACTTGATATTGAAAGATTTGAAAGAGACGACAATTC
GCCAGTATATATGGAGATTGATGAAGATCATATGAAGTGTAGAAGAAGTAAAAATACATATATGAGGATGGTTGTAATACATCGTGGAATTGAGGAAATC
TGCACAGACAGGAACAAACTCATTGACAAGCACACAATAATGTTTCCTACATCCGTATCGCTTGAGGAAGTGTCGGAGTATGTACTTAACTATCTTGAAA
AAAGATACAATATGGACAAAAAGAAACTAATTGTGAACTCTGATGGAGGAATATGGATAGACAGCTTTGTAAGAGAACTTGGAATTTACAAGCCAATACA
CATTTATGACAAGTTCCATTTAGTAAAAGCCATAGCTGAAATTTCTAAAAGGGACAAGGAAATATCAAAAAATCTTTACAAATGGCTAAAGGGAGGCGAT
TTTAAAGAACTTGAAAACTTTTATGAAAATTTCAAGGAAAAGGAGAATGTAAGTCAGAGAAGAAAAGACTATACGAAGATGCTGTTTAACCAATATGAGA
AGATAAGAAGAATATATACGGAGGAAGACTACATAGGCTCAAGGACGGAAGCCCTAGTGTCCCACGAATGCTCAAGATTTCTATCAAGTAGGCCAAAAGC
ATTTTCAAGAAGAAAGATAAAGGCAAGAGCGTTATACCACACTTTCTTTGCAAACTATGGAAAAAACAGGGAAAAGGCGTATGAATTGTACTTTAGCGGC
AAAAGAACGAGTTCACTAGAAAAGGCAATAGAGATGGAATGCTTGACAGAAATTGTTAATGAAACAGGAAAAAGCACAAATCTGCCATATTTGAGAGGAG
GAGAATGTACGCTTAGGGAAGTTTTGAAAGAAGTATCACAAAGTAAAATATTTTAAAAAAAGCAGTCAAAAAAGTTTGTTGTGGTATTTAATGACTGCCC
CTATTTTTTTTACTCTGTC
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
1344 bp447 aa1131456+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MIRISNFFSLVKTFFKNIFSFRLPFEQQFKLFVTKAFEMLFRVYVKRVDDHFFHSNERKDKFKSKGFVKRTVTTAFGDVTFERRKYVNKKTGIHYYIDEK
IGLKRYRRLSEEMIFTILFEYQYTTASFLAKTYGVSRATVYNLVNSFQMPKLDIERFERDDNSPVYMEIDEDHMKCRRSKNTYMRMVVIHRGIEEICTDR
NKLIDKHTIMFPTSVSLEEVSEYVLNYLEKRYNMDKKKLIVNSDGGIWIDSFVRELGIYKPIHIYDKFHLVKAIAEISKRDKEISKNLYKWLKGGDFKEL
ENFYENFKEKENVSQRRKDYTKMLFNQYEKIRRIYTEEDYIGSRTEALVSHECSRFLSSRPKAFSRRKIKARALYHTFFANYGKNREKAYELYFSGKRTS
SLEKAIEMECLTEIVNETGKSTNLPYLRGGECTLREVLKEVSQSKIF

 

Blast result :
Comments
References
1] Romain Guérillot and Philippe Glaser (2012) Direct submission.