ISHor2

  • Family ISLre2
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
NC_011899 ND Halothermothrix orenii
Halothermothrix orenii H 168
DNA section
IS Length : 1536 bp

Ends


IR Length : 17/24

IRL : GAACGTGTAAAATTTAAGTAGGAAAAGAAGGAAAACAAGGTATAGATAAA
IRR : GTACGTGTCAAGAAAAGGTAGGAAGAATATTTCACCTCAAACAACCCATA

Insertion site


Left flankDirect repeatRight flankDR Length
GAGATTATAAACCCCATATATAGTCAGTTG10
AGATTAAATATCGAATAAATATACGGTTTG10
TAGAAGCACTGTTAGATTAGGGTAAAATTG10
AATTTAAATAATTATGCAAAAAAGTCTTG9
AGTTTCGAAACAGTTTCTTCTAAGGTATT9
ATAATAACTTTGAGCAGAAT0
TGGTGCTGAAATTTCTAAAT0
AATTTCTAAATGGTGCTGAA0

DNA sequence

GAACGTGTAAAATTTAAGTAGGAAAAGAAGGAAAACAAGGTATAGATAAAGAAATAGAGACCTCAAACAAACCCGACCAAAGGAGTTGAGGTCTCTATGG
TAAATATTTTACTACAAAACATAACAGATATCAATACCTTGGAGAAGGCAGCACTGGAACTTGCAAGGCAGATAATGGAGAAGGTAATAGAAAAGCTTGA
AGAAGAGCTATTTAAAAATAAAGATAAAAATTTAGAAGTAGTAAGATTTTTAGAAAGAACGATATCGACTAAAGTTGGAAACATCAAGCTTAGAAGGCGA
CTATATAAAGACCAAAAAACAGGAAAAAGCGTCATTTTACTGGACAAAAAACTGGGGTTAAAAAAGAAAAAAAGAGTAAGTGGAGAATACCTAAAACTGC
TGGTAATACTGGCAAGTAAGATGAGCTACAGGCAAGTGGAGGAAGTACTGGCTGAAGCCGGTTTTCCCCATTTAAGCCATACAACTATCTTTAATGAAGT
CAGGGATTTTGGAAAAAGGGAGTCAGAGAGACTCAAACATGAAAAAGAGGAAGTATTCACTGGAGGTAAGATTTTAAAAGGAGAGGAAAAAGAAATACCA
CTACTATTCATTGAAGCTGACGGGATAATGGTTGGTAGTCAGGAAGAAGGAGGAAAGAAGCTGGAAATCAAACTGGGATTAATCCATGAGGGCTGGGAAT
ACACTAGTCCAGCAAAAAAACGGAAGAGATTGAAGGAGCCACAAATAGTAGCAGGAGTCTATGGAAAAGCAGATGACTTTTATGAAGAATTAATCCATCA
AATAAGCAAAAAATATAATCTTGAAAACACTTTAGTAGTATTAAACGGGGACGGTGCCAGCTGGATACAAAAGACCAGTAAGGAATACTTTGAAAATATA
ATAGTACAACTGGATAGGTATCATATAAAAAGAGATATAGGATTATACTTTGGAAGAGAAGTTGCAGATGATTTATGCAGGGTATTAGCAGAAGGAAGAA
AGCAGGTATTTCTGGACACATTGGAATCGTTAATATGTATGGGAGAAACAGCTGAAAACCGAGAAAAGAGGAGGAAAATAATAAAGCATTTTAAAAAGTA
TGAAGAGCACTTATTAGATTACAGATATCGAATACCAACAGAATTAAGGAATAAAGAATTACATGGGATGGGAGCAGCTGAGGGCTATGTGGATAAGAAT
GTGGCTCGCAGGATGAAGAACCAGGGAATGAATTGGAGCAAAAAAGGTGCTGAGGCAATGGCTAGAATTTTAATGTTAAAACATAACAAGGAATTAAAAG
AAAGACTTGGAGATCAGTATTACACAATAAAAAACCCGGTAAGGAAAATAAAATATATGTTTAAGAAAGTGGACAGGGATTGGAGTAAGTGGTTACAGGC
AAAAATACCTGCAATAAATGGTCCAGATAGCGGTAAAGATTGGGTAAAAGCAATAAGAGGACTGGCAACTATTTAGAATAAATATTTATGGGTTGTTTGA
GGTGAAATATTCTTCCTACCTTTTCTTGACACGTAC
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
1380 bp459 aa971476+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MVNILLQNITDINTLEKAALELARQIMEKVIEKLEEELFKNKDKNLEVVRFLERTISTKVGNIKLRRRLYKDQKTGKSVILLDKKLGLKKKKRVSGEYLK
LLVILASKMSYRQVEEVLAEAGFPHLSHTTIFNEVRDFGKRESERLKHEKEEVFTGGKILKGEEKEIPLLFIEADGIMVGSQEEGGKKLEIKLGLIHEGW
EYTSPAKKRKRLKEPQIVAGVYGKADDFYEELIHQISKKYNLENTLVVLNGDGASWIQKTSKEYFENIIVQLDRYHIKRDIGLYFGREVADDLCRVLAEG
RKQVFLDTLESLICMGETAENREKRRKIIKHFKKYEEHLLDYRYRIPTELRNKELHGMGAAEGYVDKNVARRMKNQGMNWSKKGAEAMARILMLKHNKEL
KERLGDQYYTIKNPVRKIKYMFKKVDRDWSKWLQAKIPAINGPDSGKDWVKAIRGLATI

 

Blast result :
Comments
References
1] Romain Guérillot and Philippe Glaser (2012) Direct submission.