ISLrh4

  • Family ISLre2
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
NC_013198 ND Lactobacillus rhamnosus
Lactobacillus rhamnosus ATCC 53103
Lactobacillus rhamnosus GG
DNA section
IS Length : 1577 bp

Ends


IR Length : 17/23

IRL : CATGGCGTAAAGTTTAAGTGGGTGATATCTGAGCAAACAAAAAGGGAGCG
IRR : GACGGCGTCAACTTTTTGTGGGTTTAACTTGTAAACTTTTTGCTAGAATG

Insertion site


Left flankDirect repeatRight flankDR Length
AACGCGCATAGGCTGTAAGTGGCTTTATG9
TTTAATTTCCGGGTTCACTTTAATAGTT8
GCGACTGGTGCTCATAGGTCGTTCTGTGT9
GTGAATCAAGCATATCATAAGACACATAG9
AACGCGCATAGGCTGTAAGGGCTGTAAGT9
CGAAAGTTTGATCAACAAGGCACGAACTA9
TTTAATTTCCGGGTTCACTTTAATAGTT8
GCGACTGGTGCTCATAGGTCGTTCTGTGT9
GTGAATCAAGCATATCATAAGACACATAG9
CGCCGGTTCGCGCTTAGTACGCTTAGTAA9

DNA sequence

CATGGCGTAAAGTTTAAGTGGGTGATATCTGAGCAAACAAAAAGGGAGCGAATCCCTTCGTGCTAGAATGTTAATTGCAAGAAAAACACGATAGCAGTAG
GAGGAATTCGCTCTTGTCACCTATAGTACAACAAATCATTTTAGAAATGTTGAAAGAAATTGATGAATCTGTCATGGAGATGGTCGCGGGCAAGCTGGAT
TTAAGTCAATTCATTTTAACCAATCAGGAAAACTTTCGTGAGCACCTCTGCCAGTTAGTTGGGCAGGCACTGGAACAAGTGGACCAAGCTATTATGGACA
GTGCTTACCGCCGTCGATTCTATAGCGTCAAAGATAAGCGGGAACGCACTTACTTGGCATCCATTGGCTCACTGGTTTTCACCCGACGTTATTATCAAGA
TAAACGGACTGGCGAGCGTGTCTTCTTGCTTGATGAACTCGTTGGTATTGAGAAGCGTAGCCGACTTTCGCTCGACCTCAAAGCTAAGCTGCTGGAAGAT
GCCGCCCAAATGTCTTACAAGCAATCAGGAGATCGTAACGGCGGGGGTACAAAACCATCGAAGAGCACCGTCATGCATGTTGTTCATAGAGACGGGAAGG
CCATCAGCGCTTTGGATCAGTTAAAGGATCAACCAATGCCCGTACCGGAAACATTATTTGTCGAAGCCGATGAAGATCATGTCCCCCATCAGGACGGCAC
CAATCATTTCTTGAAAATGGTTTATGTACATGAAGGTTATCGGTCTGTGGGTAAGAAGTTTCAGTTGATTAGGCCATTTTATATTACCGGTGAATACCCG
GGAACAGCTGGTACTGAAGAAATCTGGCAAACCACGCTTGATTGCATCATGAAACAATATGGCGGTCAGATGCCCAAACGCTTTTTTCTGGCCGGTGATG
GTGCCAGTTGGATCAAAACCGGGGCCGATTTTCTACCCAACTGCACGGTGGTCTACGATAAATTTCACCTACGTAAAGCGTGCAAACAAGCGGCAATTGG
CGTACCCGGTAATCTGGGCGATATTCTCATGCATTGGGCGTTACAAGGGCACTCAAGCTATCTAAATGATTATTTCCGTGTTCGGCTCAATGACCCTCAG
TTACGGTCGTCAGAACGCAAAGCTGTCCGACAAGCACGAACGCTCATTCACAAGAATTGGAAACAAATTCAGGCCAACAATGATCCAGACTTTCACGGGA
CATCAGCTGAAGGTCATATTAGTCATATGCTTTCAGAGCGCTTCAGTTCGCGGCCAATGGGCTGGTCACAAACTGGCACAGACAATTTATCACAGACGCG
GGTATACGTGCTTAAGGGCGGAAACGTTTTTGAGCGGTTAGAAGCCGAAGCCAAGGAACGTCACCAAACAAAGATTGATATTCGCGTTGATGATCGTATT
AAGATTCAGTTTAAATCAGCAGCCACGAAATACTCACAAGCGGCGCAAGCAGCGTTTGTAGAACTCGCTAGTGGGAAACATCGCGGCTGGCAATACGGTA
TCACACATCAGTTGTAAGTTGAAAAAGCATTCTAGCAAAAAGTTTACAAGTTAAACCCACAAAAAGTTGACGCCGTC
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
1404 bp467 aa1141517+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MSPIVQQIILEMLKEIDESVMEMVAGKLDLSQFILTNQENFREHLCQLVGQALEQVDQAIMDSAYRRRFYSVKDKRERTYLASIGSLVFTRRYYQDKRTG
ERVFLLDELVGIEKRSRLSLDLKAKLLEDAAQMSYKQSGDRNGGGTKPSKSTVMHVVHRDGKAISALDQLKDQPMPVPETLFVEADEDHVPHQDGTNHFL
KMVYVHEGYRSVGKKFQLIRPFYITGEYPGTAGTEEIWQTTLDCIMKQYGGQMPKRFFLAGDGASWIKTGADFLPNCTVVYDKFHLRKACKQAAIGVPGN
LGDILMHWALQGHSSYLNDYFRVRLNDPQLRSSERKAVRQARTLIHKNWKQIQANNDPDFHGTSAEGHISHMLSERFSSRPMGWSQTGTDNLSQTRVYVL
KGGNVFERLEAEAKERHQTKIDIRVDDRIKIQFKSAATKYSQAAQAAFVELASGKHRGWQYGITHQL

 

Blast result :
Comments
References
1] Romain Guérillot and Philippe Glaser (2012) Direct submission.
2] Morita,H., Toh,H., Oshima,K., Murakami,M., Taylor,T.D., Igimi,S. and Hattori,M. (2009) J Bacteriol. 191(24):7630-1