ISRasp1

  • Family IS3
  • Group IS3
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
AY582134 ND Ralstonia sp.
Ralstonia sp.
DNA section
IS Length : 1275 bp

Ends


IR Length : 31/42

IRL : TGACCTTGCCCCTGGAAACCGGATCCCTTGCTGAGTGGTTGAATACAGGC
IRR : TGACCTTGCCCGCGAGTTCCGGATCCCATAGCTGAGACCGTTACGCAGCC

Insertion site


Left flankDirect repeatRight flankDR Length
AGACTTCACCGGTGAAGTCT0

DNA sequence

TGACCTTGCCCCTGGAAACCGGATCCCTTGCTGAGTGGTTGAATACAGGCATGGAGAACGGAAGTGACGAAGGCAACGAGAGCGCGCTACACGCTGGAGT
TCAAGCTGGAAGCGGTCAGGCTGGTCAAGGCTGGCCAGAGCATGGCGGCGACGGCGAAGATCCTGGGCATTGCGCAACAGACGCTGCACAACTGGATCCG
TGCGGACCGAGACGGTCGTCTGGCGGGGGCTGGAAGCAAGCCGGTGAGCCCAGAGCAGATGGAGATCGCCAGGCTGCGCGCGGAGCTGGCGCGGGTCAAG
ATGGAGCGCGACATCCTGGGAAAAGCGACGGCGTACTTCGCGAAGGAGCGGGGGTGAAGTACGCCTGGATCGAGCGTAACCGCAAGCGCTGGCCCGTGTC
GGTGGCGTGCGCAGTTCTGGGGGTGAGCCCCAGTGGGTACCACGACCACCGTGTGCGCCAGGCACGACCACGACGTGGGATCAGCAACGATGCTCTGCTG
GTTCATATCCGAGCGATCCATGCCGAAACGCGTGGCGAGTACGGCTGGCCGCGGATCTGGAAGGAACTGCTGGCACGCGGCATTCGGGTGGGTAAGGAGC
GCGTTCGCAAGCTCATGAGCCTGCACGGCATCCGCGCCCGAGGCAAGCGCAAGTTCAAGGCTACGACCGACAGCAACCACAAGCTGCCGGTGGCGCCGAA
CCTTGTGGATCGGCAGTTCAAGCCGGCCACGCCGAACGCCGTGTGGACGAGCGACATCACGTATGTGGCCACCGACGAGGGCTGGCTGTACCTGGCGGTG
ATCATCGACCTGTTCAGCCGCCAGGTCGTGGGCTGGTCGATGCAGCCGCACATGCGGCGCGAGCTGGTGATTGACGCGTTGCACATGGCCTGGTTCCGCC
GCCATCCACCGCCGGGACTGATATGCCACAGCGATCGCGGCAGCCAATACTGCAGTGCCGACTTCCAGAAGGCGCTGACCGGCTACGGCATGCGCAGCTC
GATGAGTCGCAAGGGGAACTGCTGGGACAATGCGCCCACGGAAAGCCTGTGGGGCTCGCTCAAGGTGGGCAGGCTGCACGGCAAACGCTTCAAGACCCGG
CGCGACGCCATGGACGAGATCGTCGACTGGCTGACGTTCTACAACCACCGGCGGCTTCATTCGTCGTTGGGCTATGTCAGTCCGATGCAATTCGAACGGG
CTTGGCTTGCCGCCCAGAAAAGGCAGGCTGCGTAACGGTCTCAGCTATGGGATCCGGAACTCGCGGGCAAGGTCA
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
1185 bp394 aa511235+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MENGSDEGNESALHAGVQAGSGQAGQGWPEHGGDGEDPGHCATDAAQLDPCGPRRSSGGGWKQAGEPRADGDRQAARGAGAGQDGARHPGKSDGVLREGA
GVKYAWIERNRKRWPVSVACAVLGVSPSGYHDHRVRQARPRRGISNDALLVHIRAIHAETRGEYGWPRIWKELLARGIRVGKERVRKLMSLHGIRARGKR
KFKATTDSNHKLPVAPNLVDRQFKPATPNAVWTSDITYVATDEGWLYLAVIIDLFSRQVVGWSMQPHMRRELVIDALHMAWFRRHPPPGLICHSDRGSQY
CSADFQKALTGYGMRSSMSRKGNCWDNAPTESLWGSLKVGRLHGKRFKTRRDAMDEIVDWLTFYNHRRLHSSLGYVSPMQFERAWLAAQKRQAA

 

Blast result :
Comments
ISRasp1 is 84% (ORFAB) aa similar to ISBxe1.
There is no -1 programmed frameshift.
References
1] Shen,G.M. and Gao,M.H. (2004) Direct submission GenBank.