ISHha1

  • Family IS3
  • Group IS3
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
NC_008789 ND Halorhodospira halophila
Halorhodospira halophila SL1
DNA section
IS Length : 1264 bp

Ends


IR Length : 33/43

IRL : TGGTCTTGCCCACCAACCGTGGACACCTCAATAGCTACCATTCGACGAGG
IRR : TGGTCTTACCCAGCGAACGTGGACACGGTGTTAGCTATTAAGCCGGGCCT

Insertion site


Left flankDirect repeatRight flankDR Length
TACAGCCATCCCCGGCAGAG0

DNA sequence

TGGTCTTGCCCACCAACCGTGGACACCTCAATAGCTACCATTCGACGAGGTGATCCATGACGAGGCAAGCTACTCAGATGAGCAAGTCCAAGACGAAATC
CAAGCGCACACGCTACAGCCAGGCCTATCGAGACGAGGCGCTGGCGTTGGCCGAGCGCGTCGGGGTCAGTGAGGCGGCGCAGCAACTCGGGCTCCAGCCG
GCGCAGATCTACCAGTGGCGCACCAAGGCCCGGAACGAAGCGGACCGCTCGCAGCGAGAGCGGGAGTTGGCCGAGGAGAATGCCCGGCTCAAACGTCAGC
TCTCGGAAGCGAATGAGGAGCTGTCGATCACAAAAAAGGCCGCGGCGTACTTCGCGAAAAACCAAAAGTGAAGTACGCGTTCATCGATCAGCAGCGTCAC
GAGCACCGAGTCCAGGCGATGTGCCGCGTCCTTGGCGTCGCTCGCAGCGGCTTCTACGCATGGTGCCGGAACAAGGCGGCCCGCGCCGCACGGGAAGAAC
GCCAGCAGGCCTTTGATGGACAGGTGCAAGAGGCCTTCGAAGACTCCAGGCAACGCTCTGGGGCGCCTCGACTGACGCGAGAGCTGGACGGGCAAGGCGT
GTCGGTCAATCGCAAAACCGTGGCCCGGAGCATGCGCCGTCAGGGCCTCCGGGCACGCACGTCACGCCGGTTTAAGGTGACGACGAACTCGGCTCACAGC
CTGCCGGTCGCCCCCAATCACTTGGCCCAGTGCTTTGAAGCGGGGCAGCGGAACCAGAAGTGGACTGGCGACATCACGTATTTTGCGACCGGCGAAGGGT
GGCTCTATCTCGCGGTCGTCCTGGATCTTTGTGGCCGCAAAGTGATCGGTTGGGCCATGCGCGATCAGATGAGCGCTGAACTGGCCTGTGAGGCGCTTCT
GATGGCCCTGGAACGGCGAGGCTACCCCACGGGGGTCATCGTCCATACGGATCGCGGCAGCCAGTACTGCTCCCGTGCGTACCGCAGGCTCATCAGCGAC
TACGGGCTGATCAGCAGCATGAGCGCGAAGGGCAGCTGCTACGACAATGCCTGCAACGAGAGCTTTTTCCGTTCCCTGAAAGTCGAGGCCCTGCATGGCG
AGAAATTCCCCACGCGGGCATCGATGCGTGAGGCCGTCTTCGAATACATTGAGGGCTACTACAATCGCCGGCGTCTTCATAGCACGCTCGGGTACCTATC
CCCGGACGACTACGAGGCCCGGCTTAATAGCTAACACCGTGTCCACGTTCGCTGGGTAAGACCA
Recoding section
  • Recoding by frameshift
  • Frame
  • Type
  • Experimentally demonstrated

Stimulators :

  • Shine-Dalgarno sequence :
  • Secondary structure :

Recoding motif :

Protein section
ORF number : 3

 

ORF 1
LengthBeginEndStrandFusion ORF
294 bp97 aa78371+No
ORF function : Transposase
Description : First part of the transposase

ORF sequence :

MSKSKTKSKRTRYSQAYRDEALALAERVGVSEAAQQLGLQPAQIYQWRTKARNEADRSQRERELAEENARLKRQLSEANEELSITKKAAAYFAKNQK

 

Blast result :
ORF 2
LengthBeginEndStrandFusion ORF
918 bp305 aa3171234+No
ORF function : Transposase
Description : Second part of the transposase

ORF sequence :

GAVDHKKGRGVLREKPKVKYAFIDQQRHEHRVQAMCRVLGVARSGFYAWCRNKAARAAREERQQAFDGQVQEAFEDSRQRSGAPRLTRELDGQGVSVNRK
TVARSMRRQGLRARTSRRFKVTTNSAHSLPVAPNHLAQCFEAGQRNQKWTGDITYFATGEGWLYLAVVLDLCGRKVIGWAMRDQMSAELACEALLMALER
RGYPTGVIVHTDRGSQYCSRAYRRLISDYGLISSMSAKGSCYDNACNESFFRSLKVEALHGEKFPTRASMREAVFEYIEGYYNRRRLHSTLGYLSPDDYE
ARLNS

 

Blast result :
ORF 3
LengthBeginEndStrandFusion ORF
1157 bp385 aa781234+Yes
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MSKSKTKSKRTRYSQAYRDEALALAERVGVSEAAQQLGLQPAQIYQWRTKARNEADRSQRERELAEENARLKRQLSEANEELSITKKGRGVLREKPKVKY
AFIDQQRHEHRVQAMCRVLGVARSGFYAWCRNKAARAAREERQQAFDGQVQEAFEDSRQRSGAPRLTRELDGQGVSVNRKTVARSMRRQGLRARTSRRFK
VTTNSAHSLPVAPNHLAQCFEAGQRNQKWTGDITYFATGEGWLYLAVVLDLCGRKVIGWAMRDQMSAELACEALLMALERRGYPTGVIVHTDRGSQYCSR
AYRRLISDYGLISSMSAKGSCYDNACNESFFRSLKVEALHGEKFPTRASMREAVFEYIEGYYNRRRLHSTLGYLSPDDYEARLNS

 

Blast result :
Comments
ISHha1 is is 80% (ORFA) and 73% (ORFB) aa similar to ISAzvi9. The third ORF is a putative ORFAB transposase reconstructed in sillico by -1 frameshift.
References
1] Copeland,A., Lucas,S., Lapidus,A., Barry,K., Detter,J.C., Glavina, del Rio,T., Hammon,N., Israni,S., Dalin,E., Tice,H., Pitluck,S., Saunders,E., Brettin,T., Bruce,D., Han,C., Tapia,R., Schmutz,J., Larimer,F., Land,M., Hauser,L., Kyrpides,N., Mikhailova,N., Hoff,W and Richardson,P.(2006) Direct submission GenBank.