ISLbl1

  • Family IS3
  • Group IS3
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
NZ_AANC01000001 ND Leeuwenhoekiella blandensis
Leeuwenhoekiella blandensis MED217
DNA section
IS Length : 1435 bp

Ends


IR Length : 14/17

IRL : TGGAATTACTACATTAGACTGGACATAGAGTTGAATGAATATTATTGCAA
IRR : TGGAATTATATCGATTCTGATAGTTTAGTGCTTTACGAAAACGGAACTTT

Insertion site


Left flankDirect repeatRight flankDR Length
TTTCAAATTCTTTTATTCCG0

DNA sequence

TGGAATTACTACATTAGACTGGACATAGAGTTGAATGAATATTATTGCAAGTTGTTAACTTAGCAATCATGAGACGTAAAGCCAAACATTACACTTTAGA
GTTTAAGCAAAAAGCAGTAGAATTAAGTTACGCCAAAGGCAGTGTAGCACAGGTTTGTGAGGACCTGGATATCTTACCTGCTGTTCTTTACCGGTGGCGT
AAAGAGCAAAAGAATTATGGTAAAAATAGTTTTCCCGGCCGTGGTAACCCTAAAATGACCGATCAACAAAAAGAGATAGCCCGTTTAAAGAAACAGCTCA
AAGAAGCCGAATTAGAACGTGATATCTTAAAAAAGGCGATTGGCATCTTCTCCGCGAGCGACAAGAAAAATACAGGTTCATAAAACAGCATCGTATGAAA
TTTCCTGTTGAGAAGATGTGCACTATGTTAGCCGTGAGTAAAAGCGGTTATTACCACTGGTTGAAATCTGGTCCTAGCACCCTTTGGAAAGAAAATCAGA
AGCTCTCTTCATTAATCAAAGATATATTTGAAGATAGTCACCAAAGCTATGGAGCTCCTAGAATAAAGGCTGAATTGAAAGCTTTGGGCTTTAAGGTATC
AAAGCCTCGGGTAGCCCGTATAATGAAGGCAAACTATTTATACGCTAAGAGGAAGCGTAAGTTTAAAGCCACCACCGATAGTAACCATAAATATCCCATA
GCACCAAACTTGTTGAACCAATGCTTTAATGTAGCCAGGGCTAATCAAGTATGGGTAAGCGATATTACCTATGTTCAGACCAATCAGGGTTGGAGTTACC
TAACAGTGATCATTGATCTATTCAATAGAAAAGTTATAGGATGGGCTTTAAGTGATACCCTAAATACTGAGGATACTGTTATAAAAGCTTGGCAGATGGC
TATTAAAAATACCACACTAACACAACCTTTGATATTCCATTCAGACCAAGGTATCCAATATGCCAGCCAAAGATTTACTAATCTACTTAAAAGCTATAAT
GACCTGGTAAAACAATCGATGAGTAGAAAAGGTAATTGCTGGGACAATGCCGTAGCTGAATCCTTTTTTAAATCTCTGAAAGTAGAATGGGTATATTGGC
ATAAATACAAGCTTAAATCACAGGCAGAGTTATCTATCTTTCAGTGGATAGAAACCTGGTACAATACCAGAAGAAGACATTCCTACTTAGGAAACAGAAC
TATTAAAGAATTTGAAATAGATATGTATAATCAAAAACTAGCAGCATAGTCACTCAACTTAAAGTCCAGTTTTTTGTTGCAAGTCCAGTTTTATATTCAG
AATCAGAGTGTCATTTTTAATTTTCCATTCTCCTTTTAATTCCGAATAAATTATTTCGTGATAATGGTAGAATTTAGTCCGATGAAAAGTTCCGTTTTCG
TAAAGCACTAAACTATCAGAATCGATATAATTCCA
Recoding section
  • Recoding by frameshift
  • Frame
  • Type
  • Experimentally demonstrated

Stimulators :

  • Shine-Dalgarno sequence :
  • Secondary structure :

Recoding motif :

Protein section
ORF number : 3

 

ORF 1
LengthBeginEndStrandFusion ORF
315 bp104 aa69383+No
ORF function : Transposase
Description : First part of the transposase

ORF sequence :

MRRKAKHYTLEFKQKAVELSYAKGSVAQVCEDLDILPAVLYRWRKEQKNYGKNSFPGRGNPKMTDQQKEIARLKKQLKEAELERDILKKAIGIFSASDKK
NTGS

 

Blast result :
ORF 2
LengthBeginEndStrandFusion ORF
927 bp308 aa3231249+No
ORF function : Transposase
Description : Second part of the transposase

ORF sequence :

YLKKGDWHLLRERQEKYRFIKQHRMKFPVEKMCTMLAVSKSGYYHWLKSGPSTLWKENQKLSSLIKDIFEDSHQSYGAPRIKAELKALGFKVSKPRVARI
MKANYLYAKRKRKFKATTDSNHKYPIAPNLLNQCFNVARANQVWVSDITYVQTNQGWSYLTVIIDLFNRKVIGWALSDTLNTEDTVIKAWQMAIKNTTLT
QPLIFHSDQGIQYASQRFTNLLKSYNDLVKQSMSRKGNCWDNAVAESFFKSLKVEWVYWHKYKLKSQAELSIFQWIETWYNTRRRHSYLGNRTIKEFEID
MYNQKLAA

 

Blast result :
ORF 3
LengthBeginEndStrandFusion ORF
1181 bp393 aa691249+Yes
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MQVVNLAIMRRKAKHYTLEFKQKAVELSYAKGSVAQVCEDLDILPAVLYRWRKEQKNYGKNSFPGRGNPKMTDQQKEIARLKKQLKEAELERDILKKGDW
HLLRERQEKYRFIKQHRMKFPVEKMCTMLAVSKSGYYHWLKSGPSTLWKENQKLSSLIKDIFEDSHQSYGAPRIKAELKALGFKVSKPRVARIMKANYLY
AKRKRKFKATTDSNHKYPIAPNLLNQCFNVARANQVWVSDITYVQTNQGWSYLTVIIDLFNRKVIGWALSDTLNTEDTVIKAWQMAIKNTTLTQPLIFHS
DQGIQYASQRFTNLLKSYNDLVKQSMSRKGNCWDNAVAESFFKSLKVEWVYWHKYKLKSQAELSIFQWIETWYNTRRRHSYLGNRTIKEFEIDMYNQKLA
A

 

Blast result :
Comments
Genome in progress.
ISLbl1 is 62% (ORFA) and 68% (ORFB) aa similar to ISCce3. The third ORF is a putative ORFAB transposase reconstructed in sillico by -1 frameshift.
References
1] Pinhassi,J., Pedros-Alio,C., Ferriera,S., Johnson,J., Kravitz,S., Halpern,A., Remington,K., Beeson,K., Tran,B., Rogers,Y.-H., Friedman,R. and Venter,J.C. (2006) Direct submission GenBank.