ISRme13

  • Family IS3
  • Group IS3
MGE type ISRelated element(s) :
Isoform Synonym(s) ISRme3
Accession numberTranspositionOriginHost
NC_007971 ND Ralstonia metallidurans
Ralstonia metallidurans
DNA section
IS Length : 1288 bp

Ends


IR Length : 27/40

IRL : TGAGCTTGCCCCCGCAAAACGAATCCCTTGCTGAGGTTAAACTGAAGCAA
IRR : TGACCTTGCCCCTGTTCCACGAATCCCATAACCGAGGGAATTAGGCAGCC

Insertion site


Left flankDirect repeatRight flankDR Length
GTAATTACTTCGCAATCTGACCG3

DNA sequence

TGAGCTTGCCCCCGCAAAACGAATCCCTTGCTGAGGTTAAACTGAAGCAAGGAGAGATGTGATGACAAGCAAGACAAAGCGGGCGCAGTACACGCTGGAA
TTCAAGCTGGAAGCGGTACGGCTGGTGAAGAGCGGGCAGAGCATGGCAGTGGTTAGCGCGACCCTGGGCATCAGAGCGCAGACGCTGCATAACTGGGTCA
AGGCGGAGCGGGAAGGCAAGCTGACTGGTGCGGGTATGAAGCCGGTCAGCCCGGAGCAGATGGAGCTGGCCCGGCTTCGGGCGGAGGTGGCGCGCTTGAA
GATGGAGCGCGATATTTTAAAAAAAGCCGCAGCATACTTTGCGAAGGAGTCGGTGTGAGGTATGCGTTCATCGAGCGAAACCGACGTTACTGGCCGGTCT
CGGTCCTGTGTGAGCTGTTAGGGGTCAGCCCCAGCGGCTATCACCAGCGCAAGCAACGCACAGTAAGCACCGACAGGCCAGATAGAGGCCGACTCAGTGA
CGATGCCTTGTTGGCCCACATCAAGGCGATTCACGCCGGGGTCAAGGGGGAGTACGGCTGGCCGCGCATGTGGAAGGAACTGCTGGCGCGTGGGGTGCGG
GTGGGCAAGGAGCGTGTTCGCAAGCTGATGGCGCTGCACGGCATCCGTGCCCGCCACAAGCGCAAGTACATCGCGACAACCAACTCGAACCACGATTTGC
CGGTGGCCCCCAATCTGCTGCAACGCGACTTTAGCCCAGCAGCACCCAATCAAGTCTGGACGAGCGACATAACCTATGTGGCGACCGCCGAAGGCTGGCT
CTACCTGGTGGTCATCATCGACCTGTTCAGCCGGCAGGTGGTTGGCTGGTCGATGCAACCACACATGAAGGCCGAATTGGTCACGGACGCGCTGCGCATG
GCCTGGTTCCGGCGCCGCCCGGAAGCCGGTGTGATTGTGCACACCGACCGGGGAAGCCAGTATTGCAGCCATCTGTTTCAAGACGCCCTGAAGGCGTATG
GCATGCGCTCGTCAATGAGCCGCAGGGGCGATTGCTGGGACAACGCGCCGACTGAGAGTCTGTGGGGGTCGTTGAAGGTCGCTCGCCTGCACGGTCGCCA
GTTCGCTACCCGCCGCGCCGCAATGGACGAGGTAATTGACTGGCTTGGCTTTTATAATGCCAGCCGACTCCACTCGACGCTGGGCTACGTCAGCCCCATG
ACGTTCGAGAAAAACTGGTCCGCAGCTCAGCAACACCGGGCTGCCTAATTCCCTCGGTTATGGGATTCGTGGAACAGGGGCAAGGTCA
Recoding section
  • Recoding by frameshift
  • Frame
  • Type
  • Experimentally demonstrated

Stimulators :

  • Shine-Dalgarno sequence :
  • Secondary structure :

Recoding motif :

Protein section
ORF number : 3

 

ORF 1
LengthBeginEndStrandFusion ORF
297 bp98 aa62358+No
ORF function : Transposase
Description : First part of the transposase

ORF sequence :

MTSKTKRAQYTLEFKLEAVRLVKSGQSMAVVSATLGIRAQTLHNWVKAEREGKLTGAGMKPVSPEQMELARLRAEVARLKMERDILKKAAAYFAKESV

 

Blast result :
ORF 2
LengthBeginEndStrandFusion ORF
1056 bp351 aa1931248+No
ORF function : Transposase
Description : Second part of the transposase

ORF sequence :

LGQGGAGRQADWCGYEAGQPGADGAGPASGGGGALEDGARYFKKSRSILCEGVGVRYAFIERNRRYWPVSVLCELLGVSPSGYHQRKQRTVSTDRPDRGR
LSDDALLAHIKAIHAGVKGEYGWPRMWKELLARGVRVGKERVRKLMALHGIRARHKRKYIATTNSNHDLPVAPNLLQRDFSPAAPNQVWTSDITYVATAE
GWLYLVVIIDLFSRQVVGWSMQPHMKAELVTDALRMAWFRRRPEAGVIVHTDRGSQYCSHLFQDALKAYGMRSSMSRRGDCWDNAPTESLWGSLKVARLH
GRQFATRRAAMDEVIDWLGFYNASRLHSTLGYVSPMTFEKNWSAAQQHRAA

 

Blast result :
ORF 3
LengthBeginEndStrandFusion ORF
1187 bp395 aa621248+Yes
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MTSKTKRAQYTLEFKLEAVRLVKSGQSMAVVSATLGIRAQTLHNWVKAEREGKLTGAGMKPVSPEQMELARLRAEVARLKMERDILKKSRSILCEGVGVR
YAFIERNRRYWPVSVLCELLGVSPSGYHQRKQRTVSTDRPDRGRLSDDALLAHIKAIHAGVKGEYGWPRMWKELLARGVRVGKERVRKLMALHGIRARHK
RKYIATTNSNHDLPVAPNLLQRDFSPAAPNQVWTSDITYVATAEGWLYLVVIIDLFSRQVVGWSMQPHMKAELVTDALRMAWFRRRPEAGVIVHTDRGSQ
YCSHLFQDALKAYGMRSSMSRRGDCWDNAPTESLWGSLKVARLHGRQFATRRAAMDEVIDWLGFYNASRLHSTLGYVSPMTFEKNWSAAQQHRAA

 

Blast result :
Comments
ISRme13 is 84 % (ORFA) aa similar to ISPsy28 and 85% (ORFB) aa similar to ISBxe1. The third ORF is a putative ORFAB transposase reconstructed in silico by possible -1 frameshift.
References
1] Copeland,A., Lucas,S., Lapidus,A., Barry,K., Detter,J.C., Glavina del Rio,T., Hammon,N., Israni,S., Dalin,E., Tice,H., Martinez,M., Goltsman,E., Pitluck,S., Schmutz,J., Larimer,F., Land,M., Hauser,L., Kyrpides,N., Kim,E., Mergeay,M., Benotmane,M.A., Vallaeys,T., Michaux,A., Monchy,S., Dunn,J., McCorkle,S., Taghavi,S., van der Lelie,D. and Richardson,P. (2006) Direct submission GenBank.