ISDps1

  • Family IS3
  • Group IS3
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
NC_006138 ND Desulfotalea psychrophila
Desulfotalea psychrophila LSv54
DNA section
IS Length : 1241 bp

Ends


IR Length : 21/38

IRL : TGGAGTCCATATTAACTCGTTATAATACGAGGAACAGGAGGCTCACATGG
IRR : TGGAGCGTCACTCAAGCTATTTTTGGAACAAATAAAACTGCTCTGTGGAC

Insertion site


Left flankDirect repeatRight flankDR Length
CCCGATATTGCAAAGCTGGG0

DNA sequence

TGGAGTCCATATTAACTCGTTATAATACGAGGAACAGGAGGCTCACATGGTTATACAAAAGCGTAGAAAATATGATGCAGATTTTAAACGTAGTACTGTT
CTTTTAAGTCTAGAACCTGGTAGAACTATTAGAGAAATTGCAGATAATCTAGGCATTCATGTGGATTTGATCTATCAATGGAGAAAAAAATATGAAGAGC
AGGGAGAGATAGCGTTCCCTGGTAACGGTATTCCAGCCCTTACTGCTGAGCAGAAAAAGATCAAAGCGCTTGAGAAAGAATTGAAGAATATCACTATGGA
GAGGGACATTCTAAAAAAAGCCATGGCCATTTTCAGCAGAACACAGTGATGCATTATACTTTTATCAGGAATCATCACTCTCATTTCACTGTGAAGAAAA
TGTGCCAGACTCTTTTGATCTCAGAGAGTGGTTACTATCGTTGGTTGCAGGAACCAATTTCAAAGCGCTGCAGAGAGAATAACATTCTTAAAAATCGCAT
CCAGGAGCTCTATGTTGAGCATGGTGGAATGGTTGGTAGTCCTATGGTTACAGCTGATTTGCGAGCAGAGGCTCAGTTTGCAGATGTGGGGAAAAATCGT
GTCGCTCGAATTATGAAAGAGTCTTCAATACAGTGTAAATCTTTAAAGAAGTACAAAACTACGACTGACTCGAATCATGCTTTTCCGGTTGCACCAAATA
TCTTGAACAGAAATTTCACTGTTGCAGCCCCCAATAAGGTTTGGGTTGGTGATATAACCTACATCAAGGTAGGCAACAAATGGGCATACTTGTCTGTTTT
TATAGATCTTTATTCTAGAATAGTTGTTGGTTGGGATCTGAGTACGTCACTTGAAAAAGAATCTACAATCTGGGCACTACGTAAAGCAATTTTGCGAAGA
AACCCACCCAAAGAAATGCTTGTCCATAGCGACAGAGGTGTTCAGTACGCAAGTAAGGAATATAGACAGCTACTCCAAGAAAAAGGCTTCAGGCAAAGTA
TGAGTCGTAAGGGTAATTGCTGGGATAATGCTGTTGCAGAGTCCTTTTTTCATACGTTGAAAACACAATATATCCATCATAGGAGTTTTAGAGATATTGA
AGCAGCAAAATATGGGGCTTTTCCAGTACATCGAGGCATACTACAACCGTAGAAGAAGGCCTTCAGCTAATGGGTCCAAAAGTCCTGCAAAGTCCACAGA
GCAGTTTTATTTGTTCCAAAAATAGCTTGAGTGACGCTCCA
Recoding section
  • Recoding by frameshift
  • Frame
  • Type
  • Experimentally demonstrated

Stimulators :

  • Shine-Dalgarno sequence :
  • Secondary structure :

Recoding motif :

Protein section
ORF number : 3

 

ORF 1
LengthBeginEndStrandFusion ORF
303 bp100 aa47349+No
ORF function : Transposase
Description : First part of the transposase

ORF sequence :

MVIQKRRKYDADFKRSTVLLSLEPGRTIREIADNLGIHVDLIYQWRKKYEEQGEIAFPGNGIPALTAEQKKIKALEKELKNITMERDILKKAMAIFSRTQ

 

Blast result :
ORF 2
LengthBeginEndStrandFusion ORF
879 bp292 aa2741152+No
ORF function : Transposase
Description : Second part of the transposase

ORF sequence :

ERIEEYHYGEGHSKKSHGHFQQNTVMHYTFIRNHHSHFTVKKMCQTLLISESGYYRWLQEPISKRCRENNILKNRIQELYVEHGGMVGSPMVTADLRAEA
QFADVGKNRVARIMKESSIQCKSLKKYKTTTDSNHAFPVAPNILNRNFTVAAPNKVWVGDITYIKVGNKWAYLSVFIDLYSRIVVGWDLSTSLEKESTIW
ALRKAILRRNPPKEMLVHSDRGVQYASKEYRQLLQEKGFRQSMSRKGNCWDNAVAESFFHTLKTQYIHHRSFRDIEAAKYGAFPVHRGILQP

 

Blast result :
ORF 3
LengthBeginEndStrandFusion ORF
1106 bp368 aa471152+Yes
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MVIQKRRKYDADFKRSTVLLSLEPGRTIREIADNLGIHVDLIYQWRKKYEEQGEIAFPGNGIPALTAEQKKIKALEKELKNITMERDILKKSHGHFQQNT
VMHYTFIRNHHSHFTVKKMCQTLLISESGYYRWLQEPISKRCRENNILKNRIQELYVEHGGMVGSPMVTADLRAEAQFADVGKNRVARIMKESSIQCKSL
KKYKTTTDSNHAFPVAPNILNRNFTVAAPNKVWVGDITYIKVGNKWAYLSVFIDLYSRIVVGWDLSTSLEKESTIWALRKAILRRNPPKEMLVHSDRGVQ
YASKEYRQLLQEKGFRQSMSRKGNCWDNAVAESFFHTLKTQYIHHRSFRDIEAAKYGAFPVHRGILQP

 

Blast result :
Comments
ISDps1 is 69 % (ORFA) aa similar to ISHor1 and 65% (ORFB) aa similar to ISCce3. The third ORF is a putative ORFAB transposase reconstructed in sillico by possible -1 frameshift.
References
1] Rabus,R., Ruepp,A., Frickey,T., Rattei,T., Fartmann,B., Stark,M., Bauer,M., Zibat,A., Lombardot,T., Becker,I., Amann,J., Gellner,H., Teeling,H., Leuschner,W.D., Gloeckner,F.-O., Lupas,A.N., Amann,R. and Klenk,H.-P.(2004) Environ. Microbiol. 6 (9), 887-902