ISLve1

  • Family IS3
  • Group IS3
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
NZ_AAMS01000006.1 ND Loktanella vestfoldensis
Loktanella vestfoldensis SKA53
DNA section
IS Length : 1231 bp

Ends


IR Length : 28/36

IRL : TGGTCTTGTCACGGTTTGGTGCCGCTCCTTTGATCACGTAATGTGCAGCA
IRR : TGGTCTTGTCACGTATTTGTGCCGCCCCCGGTGCTCGTTTAGGCCACTTG

Insertion site


Left flankDirect repeatRight flankDR Length
CACGGAGGAACCCTAACCCTA1

DNA sequence

TGGTCTTGTCACGGTTTGGTGCCGCTCCTTTGATCACGTAATGTGCAGCAAAGGAGAACAGCTATGGGCACAGGAAGAACAGACGAATTTCGCAAAGATG
CGGTGCGGATCGCGTTGACCAGCGGGCTTTCGCGGCGTCAGGATTCGGATGATCTGGGGGTCGGCTTATCGACCTTGAACAAGTGGGTGAACGCGCACCG
CGACACGGATGTGGTCTCAGCCGAGGATCGCGAGTTGGCGCGGGAGAATGAACGGCTTCGGCGTGAGATCCGCATCCTCAAGGAGGAGAGGGACATCCTA
AAAAAAGCCACCCAGTTCTTCGTGAGCCAAAAGCCGTGAGGTTCAGGTTCGTAGAAGAACAGTGCGGGGCCTTCCCAATCGACCGGTTGTGCCGGGTGAT
GAATGTCAGCCCACGTGGCCTACGGGCGTTCCGCAGCCGCCCAGCCAGCCGCAGGCAGCGCATGGATATGGTGGTTCTGGCCCACATCAAGGAATAGTCG
CGCCTGAGCCTGGGCAGCTATGGCCGCCCACGAATGACCGAAGAGTTGAAGGAGGTCGGTGTCGATGTTGGGCATCGCAGGGTTGGAAGGCTGATGCGTG
AGAACGGGATTGTCGTTGAAAGAACGAGAAAATTCAAAGCGACGACGGACAGCAACCACATGTTCAATATCGCGCCGAACCTGCTGGATCGTGACTTCAC
GGCGGATCGGCCCAACCAGAAATGGGCGGGCGATATCAGCTATGTCTGGACCCGGGAGGGGTGGCTGTATCTCGCTGTCATCCTAGATCTGCATTCCCGG
CGCGTCATCGGCTGGGCGGTCAGTGACCGCATGAAGCGCGACCTGGCGATCCGGGCGCTAAAAATGGCCATCGCTCTGCGATCACCGCCCAAGGGCTGCA
TCTTCCACAGTGATCGCGGCAGCCAATACTGTTCGCATGACTACCAGAAAATCCTGCGCGAGCGTGGGTTCAAAGTGTCGATGAGCGGCAAGGGTAACTG
CTATGACAACGCCGCAGTCGAGACCTTCTTCAAAACTATCAAGGCCGAGCTGATCTGGCGACGCCATTGGGAAACCCGCCGACAGGCTGAGACGGCCATC
TTCCAATACATCAACGGCTTCTGTAACCCGCGCCGTCGGCACTCAGCATTGGGAGGCAAAAGCCCCTTGGCATTCGAACGCCAAGTGGCCTAAACGAGCA
CCGGGGGCGGCACAAATACGTGACAAGACCA
Recoding section
  • Recoding by frameshift
  • Frame
  • Type
  • Experimentally demonstrated

Stimulators :

  • Shine-Dalgarno sequence :
  • Secondary structure :

Recoding motif :

Protein section
ORF number : 3

 

ORF 1
LengthBeginEndStrandFusion ORF
276 bp91 aa64339+No
ORF function : Transposase
Description : First part of the transposase

ORF sequence :

MGTGRTDEFRKDAVRIALTSGLSRRQDSDDLGVGLSTLNKWVNAHRDTDVVSAEDRELARENERLRREIRILKEERDILKKATQFFVSQKP

 

Blast result :
ORF 2
LengthBeginEndStrandFusion ORF
927 bp308 aa2671193+No
ORF function : Transposase
Description : Second part of the transposase

ORF sequence :

DPHPQGGEGHPKKSHPVLREPKAVRFRFVEEQCGAFPIDRLCRVMNVSPRGLRAFRSRPASRRQRMDMVVLAHIKE*SRLSLGSYGRPRMTEELKEVGVD
VGHRRVGRLMRENGIVVERTRKFKATTDSNHMFNIAPNLLDRDFTADRPNQKWAGDISYVWTREGWLYLAVILDLHSRRVIGWAVSDRMKRDLAIRALKM
AIALRSPPKGCIFHSDRGSQYCSHDYQKILRERGFKVSMSGKGNCYDNAAVETFFKTIKAELIWRRHWETRRQAETAIFQYINGFCNPRRRHSALGGKSP
LAFERQVA

 

Blast result :
ORF 3
LengthBeginEndStrandFusion ORF
1130 bp376 aa641193+Yes
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MGTGRTDEFRKDAVRIALTSGLSRRQDSDDLGVGLSTLNKWVNAHRDTDVVSAEDRELARENERLRREIRILKEERDILKKSHPVLREPKAVRFRFVEEQ
CGAFPIDRLCRVMNVSPRGLRAFRSRPASRRQRMDMVVLAHIKE*SRLSLGSYGRPRMTEELKEVGVDVGHRRVGRLMRENGIVVERTRKFKATTDSNHM
FNIAPNLLDRDFTADRPNQKWAGDISYVWTREGWLYLAVILDLHSRRVIGWAVSDRMKRDLAIRALKMAIALRSPPKGCIFHSDRGSQYCSHDYQKILRE
RGFKVSMSGKGNCYDNAAVETFFKTIKAELIWRRHWETRRQAETAIFQYINGFCNPRRRHSALGGKSPLAFERQVA

 

Blast result :
Comments
Genome in Progress.
ISLve1 is 84% (ORFA) aa similar to ISShsp3 and 86% (ORFB) aa similar to IS1133. The third ORF is a putative ORFAB transposase reconstructed in silico by -1 frameshift but interrupted by à TAG codon at 497th nt.
References
1] Hagstrom,A., Ferriera,S., Johnson,J., Kravitz,S., Halpern,A., Remington,K., Beeson,K., Tran,B., Rogers,Y.-H., Friedman,R. and Venter,J.C. (2006) Direct Submission GenBank.