ISRaq1

  • Family IS3
  • Group IS407
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
AY528232 ND Rahnella aquatilis
Rahnella aquatilis
DNA section
IS Length : 1221 bp

Ends


IR Length : 36/46

IRL : TGACCTGCTCCCAGTTGATTAATACACCACGATGTTAGTAATGTCTTCAT
IRR : TGACCTGCCCCCAGGATTAGATACAACCGTCAGTTAGTAATGTCGGTTTG

Insertion site


Left flankDirect repeatRight flankDR Length

DNA sequence

TGACCTGCTCCCAGTTGATTAATACACCACGATGTTAGTAATGTCTTCATAAGCCACATGAGGACATCCCCATGAAGAAGCGTTTTTCCGACGAACAGAT
CATCAGTATCCTCCGCGAGGCTGAAGCCGGGGTTTCTGCCCGTGAGCTCTGCCGTAAGCACGCCATTTCCGACGCCACCTTTTACACCTGGCGTAAGAAG
TATGGCGGTATGGAGGTGCCCGAGGTTAAGCGCCTGAAGTCGCTTGAGGAAGAGAACGCCAGGCTCAAGAAGCTGCTTGCCGAAGCCATGCTGGATAAGG
AGGCGCTTCAGGTGGCTCTGGGGCGAAAGTACTGACGACAGACCAGAAGCGGGAAGCCGTGATGTTGATGTGTGATGCGACCGGTCTGTCGCAACGTCGT
GCCTGCAGGCTTACAGGTTTGTCCCTGTCGACCTGCCGTTATGATGCTCAGCGTCCGGCTGCTGATGCACATTTATCAGGGCGTATTACTGAGCTGGCGC
TTGAACGCAGACGTTTTGGTTATCGGCGTATCTGGCAGTTGCTGCGTAGGGAGGGCCTTCACGTCAATCACAAGCGGGTATACCGTATTTACCACCTTAA
TGGACTGAGCGTAAAACGCAGACGACGCCGTAAAGGGCTGGCGACCGAACGGTTTCCGCTTCTTCGCCCGGATGCGCCGAACCTTACATGGTCGATGGAT
TTCGTTATGGACGCACTGGTCAACGGTCGCAGGATCAAGTGCCTGACCTGTGTGGATGATTTCACGAAGGAGTGTCTGACGATCACCGCTGCTTTCGGTA
TTTCAGGCGTTCAGGTCACGCGTATTCTGGACAGCATCGCGTTGTTTCGGGGCTATCCGGCGACAATAAGAACCGATCAGGGCCCGGAATTTACCTGCCG
CGCGCTCGATCAATGGGCCTTTGAGCATGGTGTGGAACTACGGCTTATCCAGCCAGGTAAGCCAACGCAGAACGGATTTATTGAGAGTTTTAACGGACGC
TTTCGCGATGAGTGTCTGAACGAACACTGGTTCAGCGATATCGTTCACGCCAGGAAAACCATTAACGACTGGAGGCAGGATTATAACGAGTGTCGTCCAC
ATTCGGCACTGAATTATCAGGCGCCGTCTGAATTTGCAGCACGGTGGCGAAATGGAAAATGTGAAGGTAAACAAACCGACATTACTAACTGACGGTTGTA
TCTAATCCTGGGGGCAGGTCA
Recoding section
  • Recoding by frameshift
  • Frame
  • Type
  • Experimentally demonstrated

Stimulators :

  • Shine-Dalgarno sequence :
  • Secondary structure :

Recoding motif :

Protein section
ORF number : 3

 

ORF 1
LengthBeginEndStrandFusion ORF
264 bp87 aa72335+No
ORF function : Transposase
Description : First part of the transposase

ORF sequence :

MKKRFSDEQIISILREAEAGVSARELCRKHAISDATFYTWRKKYGGMEVPEVKRLKSLEEENARLKKLLAEAMLDKEALQVALGRKY

 

Blast result :
ORF 2
LengthBeginEndStrandFusion ORF
894 bp297 aa2991192+No
ORF function : Transposase
Description : Second part of the transposase

ORF sequence :

GGASGGSGAKVLTTDQKREAVMLMCDATGLSQRRACRLTGLSLSTCRYDAQRPAADAHLSGRITELALERRRFGYRRIWQLLRREGLHVNHKRVYRIYHL
NGLSVKRRRRRKGLATERFPLLRPDAPNLTWSMDFVMDALVNGRRIKCLTCVDDFTKECLTITAAFGISGVQVTRILDSIALFRGYPATIRTDQGPEFTC
RALDQWAFEHGVELRLIQPGKPTQNGFIESFNGRFRDECLNEHWFSDIVHARKTINDWRQDYNECRPHSALNYQAPSEFAARWRNGKCEGKQTDITN

 

Blast result :
ORF 3
LengthBeginEndStrandFusion ORF
1121 bp373 aa721192+Yes
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MKKRFSDEQIISILREAEAGVSARELCRKHAISDATFYTWRKKYGGMEVPEVKRLKSLEEENARLKKLLAEAMLDKEALQVALGRKVLTTDQKREAVMLM
CDATGLSQRRACRLTGLSLSTCRYDAQRPAADAHLSGRITELALERRRFGYRRIWQLLRREGLHVNHKRVYRIYHLNGLSVKRRRRRKGLATERFPLLRP
DAPNLTWSMDFVMDALVNGRRIKCLTCVDDFTKECLTITAAFGISGVQVTRILDSIALFRGYPATIRTDQGPEFTCRALDQWAFEHGVELRLIQPGKPTQ
NGFIESFNGRFRDECLNEHWFSDIVHARKTINDWRQDYNECRPHSALNYQAPSEFAARWRNGKCEGKQTDITN

 

Blast result :
Comments
ISRaq1 is 100% (ORFA) and 94% (ORFB) aa similar to IS1222. The third ORF is a putative ORFAB transposase reconstructed in silico by possible -1 frameshift.
References
1] Mejlhede,N., Licznar,P., Prere,M.F., Wills,N.M., Gesteland,R.F., Atkins,J.F. and Fayet,O. (2004) J. Bacteriol. 186 (10), 3274-3277.