ISRssp1

  • Family IS3
  • Group IS407
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
NZ_AATQ01000050 ND Roseovarius sp.
Roseovarius sp. HTCC2601
DNA section
IS Length : 1253 bp

Ends


IR Length : 34/45

IRL : TGACCTGCCCCCCGCGAAATCCCTCACCGTAATGTAGAGTCTGCGCCAAC
IRR : TGACCTGCACCCCGCTGGTCCCTCATTCATAACGAGAGTCTGCAGTTTGG

Insertion site


Left flankDirect repeatRight flankDR Length
TGCCATACTGCGGAATAGAGAGAT4

DNA sequence

TGACCTGCCCCCCGCGAAATCCCTCACCGTAATGTAGAGTCTGCGCCAACTCTGAAGGAGCAGACACATGCGAAAGAGCCGTTTTACCGAGGCGCAGATC
ATCGGAATGATCAAGGAGCAGGAGGCAGGGATGCCGGCTGCGGAAGTGTGCCGTAGGCATGGGCTGAGCACTGCGACGTTCTACAAGCTGAAGGCCAAGT
ATGGCGGCATGGAGGTGTCCGAGGCTGCCAGGCTAAAGGCCCTTGAGGACGAGAATGCCAAGCTGAAGCGCCTGCTGGCGGACACCATGCTGGACAATGT
CGTGTTGAAAGACCTGCTGGGAAAGAACTGACGACATTGACGAAGCGGCGAGATGCGGCGCTCCGGGTGATGCGGGATCATGACATCTCGCAGCGCCGGG
CCTGTAGGCTGGTTGGTGTCGATCCCAAGACCGTTCGGCGTGAACGCCCGTCGGACAGTGCCGATATCCGCCAAGAGATGCAGGAGATCGCCGGCAAGCG
GCGTCGGTTCGGGTATCGCCGGATCGGGGTCCTGCTGGAACGCAAGGGCATGATCATGAACCACAAGAAGCTGTATCGCATCTATCGCGAGGAAGGGCTT
TCGGTGAAACGACGGCGAGGCCGGAAACGGGCGCGCGGCACGAGGACGCCGATGCCGGTTGCCGCGTGGCCCAACGCGCGCTGGTCGTTGGACTTCGTGT
CCGACAGCTTTGGCGCGTCGCGGAAGTTCCGGATCCTGGTGGTGATTGATGACTGCACCCGGGAATGCCTGTGCCTCGTCGCGGACACCAGCCTGTCAGG
GGCGCGTGTCGCCCGGGAACTCAGCTCCCTGATCCGGATTTACGGCAAGCCGGGTTGCATCGTCAGTGACAATGGCACCGAGTTCACCAGTCGGGCCATC
CTCAAATGGGCCGACGAGAACGAGTTGCCGTGGCACTACATCGACCCAGGCAAGCCCCAGCAGAATGCCTTCGTCGAAAGCTTCAACGGCAGCCTGCGGG
AAGAGCTACTCAATGAGGAAATCTTCGACAGCTTGGACGACGCACGGCGAAAGCTGGCGCTCTGGCGCTACGACTACAACACGATCAGGCCACACTCGTC
CCTGGCCAACCAGACGCCGCAGCAAGCGCGCCGGACGCTTGAGAAATTTGAGGGCTTCGCGCCCGGCGCGCTTGCGCCAGACGACCAAGCCGAATACCGA
AATCCAAACTGCAGACTCTCGTTATGAATGAGGGACCAGCGGGGTGCAGGTCA
Recoding section
  • Recoding by frameshift
  • Frame
  • Type
  • Experimentally demonstrated

Stimulators :

  • Shine-Dalgarno sequence :
  • Secondary structure :

Recoding motif :

Protein section
ORF number : 3

 

ORF 1
LengthBeginEndStrandFusion ORF
264 bp87 aa68331+No
ORF function : Transposase
Description : First part of the transposase

ORF sequence :

MRKSRFTEAQIIGMIKEQEAGMPAAEVCRRHGLSTATFYKLKAKYGGMEVSEAARLKALEDENAKLKRLLADTMLDNVVLKDLLGKN

 

Blast result :
ORF 2
LengthBeginEndStrandFusion ORF
981 bp326 aa2471227+No
ORF function : Transposase
Description : Second part of the transposase

ORF sequence :

GRECQAEAPAGGHHAGQCRVERPAGKELTTLTKRRDAALRVMRDHDISQRRACRLVGVDPKTVRRERPSDSADIRQEMQEIAGKRRRFGYRRIGVLLERK
GMIMNHKKLYRIYREEGLSVKRRRGRKRARGTRTPMPVAAWPNARWSLDFVSDSFGASRKFRILVVIDDCTRECLCLVADTSLSGARVARELSSLIRIYG
KPGCIVSDNGTEFTSRAILKWADENELPWHYIDPGKPQQNAFVESFNGSLREELLNEEIFDSLDDARRKLALWRYDYNTIRPHSSLANQTPQQARRTLEK
FEGFAPGALAPDDQAEYRNPNCRLSL

 

Blast result :
ORF 3
LengthBeginEndStrandFusion ORF
1160 bp386 aa681227+Yes
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MRKSRFTEAQIIGMIKEQEAGMPAAEVCRRHGLSTATFYKLKAKYGGMEVSEAARLKALEDENAKLKRLLADTMLDNVVLKDLLGKELTTLTKRRDAALR
VMRDHDISQRRACRLVGVDPKTVRRERPSDSADIRQEMQEIAGKRRRFGYRRIGVLLERKGMIMNHKKLYRIYREEGLSVKRRRGRKRARGTRTPMPVAA
WPNARWSLDFVSDSFGASRKFRILVVIDDCTRECLCLVADTSLSGARVARELSSLIRIYGKPGCIVSDNGTEFTSRAILKWADENELPWHYIDPGKPQQN
AFVESFNGSLREELLNEEIFDSLDDARRKLALWRYDYNTIRPHSSLANQTPQQARRTLEKFEGFAPGALAPDDQAEYRNPNCRLSL

 

Blast result :
Comments
Genome in progress.
ISRssp1 is 91 % (ORFA) aa similar to ISR1 and 71% (ORFB) aa similar to ISRpa2. The third ORF is a putative ORFAB transposase reconstructed in silico by possible -1 frameshift.
References
1] Giovannoni,S.J., Ferriera,S., Johnson,J., Kravitz,S., Halpern,A., Remington,K., Beeson,K., Tran,B., Rogers,Y.-H., Friedman,R. and Venter,J.C. (2006) Direct Submission GenBank.