ISRme4

  • Family IS21
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
NC_007973 ND Cupriavidus metallidurans
Cupriavidus metallidurans CH34
DNA section
IS Length : 2469 bp

Ends


IR Length : 27/28

IRL : TGTTGATTTGCACTGAATCCTGACCCACCCACGGCAGGTATTTGCATCGA
IRR : TGTTGATTTGCACCGAATCCTGACCCACGATTTGCATCGAAAATTGACCC

Insertion site


Left flankDirect repeatRight flankDR Length
GCAGAGTGCCATGTCCATAGAACGGTGGACTTGGAGACCTC0
AGCTCAAGGATGAGCAAGCTTCCCAAGCTATCGAAGAAGA0

DNA sequence

TGTTGATTTGCACTGAATCCTGACCCACCCACGGCAGGTATTTGCATCGAATGTTGACCCACGTATAGAACACTTGCCCGCTTGGGAACGAGCGGGAGTT
CGGAGTGATCGACGTGGCCATACTGAGCATCATTCGACGCTGGCATCTTCGCGACCAGATCCCGCTGCGCGAGATCGCCAGACGCCTGGGTATTTCCAGG
AATACGGTCAGGCGCTATCTGCGCACTGACGTCACAGCACCCGCCTACCCCACACGGCAGAGCCCGAGCAAGCTCGACGGCCATGCCGCCAAGCTCGCCG
CGTGGCTCAAGACCGAGGCCAACAAGCCGCGTAAGCAACGACGCACGCTCAAGCAGATCCATGCCGATCTGTGTGCTCTGGGCTTCACGGGTTCCTATGA
TCGAGTCGCGGCGTTCGCGCGTCGCTGGCGTCAGGAACAGCAAGAGCAAGCGCGATCGTCGGGCCGCGGCACCTACATCCCCTTGCGCTTCGCCGAGGGT
GAGGCCTTCCAGTTCGACTGGAGCGAGGACTGGGCCGTCATCGCCGGCGAGCGCACCAAGCTGCAGGTGGCCCAGTTCAAGCTGAGCCACAGTCGGGCCT
TCTTCCTGCGCGCCTACCTGTTGCAGACCCACGAGATGCTGTTCGATGCCCATCACCATGCCTTTGTGGCGTGGGGCGGGATCCCGCGCCGCGGCATCTA
CGACAACATGAAGACGGCCGTCGACCGGGTGCGCCAGGGCAAGCTGCGCGACGTCAACCTGCGCTTTGGCACCATGGTCAGCCATTACCTGTTCGATGCC
GAGTTCTGCAATCCAGCCTCGGGCTGGGAGAAGGGCCAGATCGAGAAGAATGTCCAGGACAGCCGTCACCGGATCTGGCAACGTGTTCCTGCCTTCGGCT
CTCTGGCCGCGCTTAATGATTGGTTGGCCGACCAATGCGTGCGCCTGTGGCAGCAGACCCGCCACCCGGAGCTGGATATGACCATCTGGGAAGCCTGGTC
ACTGGAGCGGCCGCACCTGATGCCGGTGGGGCAGGCGTTCGACGGCTTTGTCGAACACACCAAGCGCGTGTCGCCTACCTGCCTGGTGAACTTCGAGCGC
AACCGCTACAGCGTGCCTGCCTCGTTTGCCAACCGGCCCATCAGTCTGCGTGTCTATGCCACGCGGCTCTTGTTTGTCGCCGAAGGCCAGGTGATTGCCG
AGCACGTACGGCACATCAATCGCGGTCACCATCCCGGCCATACGGTCTATGACTGGCGCCACTACCTCGCGGTGCTGCAGCGCAAGCCTGGCGCGCTGCG
CAACGGCGCACCGTTCGCCGAGTTGCCAGAGGGCTTCCGGCGCCTGCAGGCTACGCTGCTCAAGCGGCCCGGCGGCGATCGGGAGATGGTCGAGATCTTG
GCGCTTGTCCTATTGCACGACGAACAGGCCGTGCTGACCGCGGTGGAGCTGGCGCTCGAGGCAGGTGCCGCCTCCAAGCAGACCGTCCTCAATATCCTCA
GCCGCCTGCTCGAAGGTGGACCGGTAGCCCCCATCACCACGCCTCAGGCGCTGGCTTTGCAGGTCGAGCCGCAGGCCAACGTCGCGCGTTATGACAGTCT
GCGTGACCGGGAGGTGCCGCATGCAGCATGAAGCCATGATGGAGATGCTCAAATCCTTGAAGCTGCACGGCATGGCTCACGCGCTTGGCGACCTGGCGGC
GCAGGACTCGCCGGCCTATCAGTCCGCCGTCGCCATTCTGTCTCGCCTGCTCAAGGCAGAAACCACTGAGCGTGAAGTGCGCTCGCTGGCCTATCAGATG
AAGGTGGCGCGCTTTCCGGCCTACCGGGATCTGACCGGCTTCGACTTCAGTTGCAGCGAGGCCAACGAGGCGCTGGTGCGGCAACTCCACCGCTGCGAGT
TCCTAGAATCCGCCCACAACGTGGTGCTGGTCGGCGGCCCTGGCACGGGCAAGACGCATCTGGGTACCGCCATCGGTGTACAGGCCGTGGAGCATCACCA
CCGCCGGGTGCGCTTCTTCTCGACCGTCGAACTGGTCAACGCACTGGAACTGGAGAAGGTCTCTGGCAAGCCCGGCCATCTGGCCACGCGACTGATGTAC
GCAGACCTGGTGATCCTCGATGAGTTGGGCTATCTGCCCTTCAGCCAGGTCGGTGGCGCATTGCTGTTTCATCTGATCAGCAAGCTCTACGAGCGCACCA
GCCTGATCATCACCACCAACCTCAGCTTCGGGGAATGGTCCAGTGTCTTTGGGGATGCCAAGATGACCACTGCGCTGCTCGACCGCCTTACCCATCACTG
CCACATTGTGGAGACCGGAAACGATAGCTATCGTTTCAAGCACAGCACCACCCAACCAAAAAAGGAGAAACGCACCGCAAAACAGCCCGCACAAAGCGAC
ACCTAACAGCTTTTGGGGTGGGTCAATTTTCGATGCAAATCGTGGGTCAGGATTCGGTGCAAATCAACA
Protein section
ORF number : 2

 

ORF 1
LengthBeginEndStrandFusion ORF
994 bp331 aa6351628+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MLFDAHHHAFVAWGGIPRRGIYDNMKTAVDRVRQGKLRDVNLRFGTMVSHYLFDAEFCNPASGWEKGQIEKNVQDSRHRIWQRVPAFGSLAALNDWLADQ
CVRLWQQTRHPELDMTIWEAWSLERPHLMPVGQAFDGFVEHTKRVSPTCLVNFERNRYSVPASFANRPISLRVYATRLLFVAEGQVIAEHVRHINRGHHP
GHTVYDWRHYLAVLQRKPGALRNGAPFAELPEGFRRLQATLLKRPGGDREMVEILALVLLHDEQAVLTAVELALEAGAASKQTVLNILSRLLEGGPVAPI
TTPQALALQVEPQANVARYDSLRDREVPHAA

 

Blast result :
ORF 2
LengthBeginEndStrandFusion ORF
814 bp271 aa15902403+No
ORF function : Accessory Gene
AG : IS21 helper

ORF sequence :

MTVCVTGRCRMQHEAMMEMLKSLKLHGMAHALGDLAAQDSPAYQSAVAILSRLLKAETTEREVRSLAYQMKVARFPAYRDLTGFDFSCSEANEALVRQLH
RCEFLESAHNVVLVGGPGTGKTHLGTAIGVQAVEHHHRRVRFFSTVELVNALELEKVSGKPGHLATRLMYADLVILDELGYLPFSQVGGALLFHLISKLY
ERTSLIITTNLSFGEWSSVFGDAKMTTALLDRLTHHCHIVETGNDSYRFKHSTTQPKKEKRTAKQPAQSDT

 

Blast result :
Comments
ISRme4 is present in two copies on the chromsome of C. metallidurans CH34.
ISRme4 is 80% (ORFA) and 87% (ORFB) aa similar to IS1600.
References
1] Sébastien Monchy. (2007) Direct submission.