ISFba1

  • Family IS1595
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
NZ_AAXX01000001 ND Flavobacteria bacterium
Flavobacteria bacterium BAL38
DNA section
IS Length : 986 bp

Ends


IR Length : 19/24

IRL : CTGATTGTCCGTAAGCACTCATAATAGATAAAAATTTCATATATTTGATA
IRR : CTGATTGTCCGTTTTCTGTCATAACCCTGTAATATTAGCAATTACAAGCC

Insertion site


Left flankDirect repeatRight flankDR Length
TTATATTTTGATATTATTTTTAATATAAATTAAAA9

DNA sequence

CTGATTGTCCGTAAGCACTCATAATAGATAAAAATTTCATATATTTGATAAAAATTCAAGACATGAACTTATTTAATTTTACAGCAAATTTTGGAAGTGA
AGAAGCTTGTAGACTCCATTTTAAAGAACAAAGAGATGAGATAGGAGTTGAATGTAAATGTGGTTCAAAAGAGCATTTTTGGATACAGAGTCGTTGGAGT
TATGAATGTAAAAAGTGTAGAAGTAGAATTTCTTTACGAAGCGGAACTATAATGCAAAGTTCAAAGTTGTCATTTTTGACTTGGTACAAAACTATGTTTT
TAATGAGTGCTACAAAAAAAGGATTTTCAAGTAAAGAAATCCAAAAGCAACTTGGACAAAAAAGATACGAACCAGTTTGGGCAATGGTTCATAAGTTAAG
AAAGGCTATGGGTAACCGAGATGCTCGATATACCTTAGAAGGTATGATTGAATTTGATGAAGGCTATTTTACTGTTGAATCTTCTGAAATTGAACAAGAA
AAAGGCATTCGAGGTAGAGGTGCAGTTGGTAAAGAAAATGTTGCAATTATGGCAGAATCAACAGTTTTGGAAGATTTGGAAAGCGGTAAAAAATCAACAC
AATGTCGTTATTTTAAAGCTAAAGTTTTAACCAACCATACTGCTGAGCAAATTAATCAAACAATACAAGAATCAATTAATGAAAAAAGTATTGTTTTTAC
AGATAAAAGTACATCATATGTAGATATTTCTAACTTTGTAGAATTGCACATAACTGAAAAATCTAACAAAGAAACCACAAAAGAAACTTTGAAATGGGTT
CATATAACAATCAGTAACGCAAAAAGAAATTTGTTAGGAAATTACCATAAAATAAAAGGAAAATATCTTCAATTATATCTAAACGAGTTTGTGTACAAGT
TAAATAGAAGATATTTTGAAGAAAAACTTTTCGATAGGCTTGTAATTGCTAATATTACAGGGTTATGACAGAAAACGGACAATCAG
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
906 bp301 aa63968+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MNLFNFTANFGSEEACRLHFKEQRDEIGVECKCGSKEHFWIQSRWSYECKKCRSRISLRSGTIMQSSKLSFLTWYKTMFLMSATKKGFSSKEIQKQLGQK
RYEPVWAMVHKLRKAMGNRDARYTLEGMIEFDEGYFTVESSEIEQEKGIRGRGAVGKENVAIMAESTVLEDLESGKKSTQCRYFKAKVLTNHTAEQINQT
IQESINEKSIVFTDKSTSYVDISNFVELHITEKSNKETTKETLKWVHITISNAKRNLLGNYHKIKGKYLQLYLNEFVYKLNRRYFEEKLFDRLVIANITG
L

 

Blast result :
Comments
ISFba1 is 54% aa similar to ISCku1.
References
1] Hagstrom,A., Ferriera,S., Johnson,J., Kravitz,S., Beeson,K., Sutton,G., Rogers,Y.-H., Friedman,R., Frazier,M. and Venter,J.C. (2007) Direct submission GenBank.