ISRpa6

  • Family ISAs1
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
NC_008435 ND Rhodopseudomonas palustris
Rhodopseudomonas palustris BisA53
DNA section
IS Length : 1193 bp

Ends


IR Length : 17/20

IRL : CAGGGGAATCGCATGTTGGCTTGTGCAAGTAGTTGCCAAATCGAAGGAAA
IRR : CAGGGCTATCGCATGTGGCCGAGGAGTTCGAAGAGGAAGGCGTCGTTCCA

Insertion site


Left flankDirect repeatRight flankDR Length
CCACAGCCCTCCCCACGAGGGGGAGAGAGCGCTCAGT10

DNA sequence

CAGGGGAATCGCATGTTGGCTTGTGCAAGTAGTTGCCAAATCGAAGGAAATGGATTCTGAGGGATGCTCCTGTCGTGAAGGGAGCAGGCGATGGAGCGAT
TTGCGGAATGCTTTTCGGAGTTGCCGGACCCGCGTGCGGACAACGCGCTGCATGACCTGACGGAGATCTTGTTCATCGCGCTGATGGCGACCTTGTGCGG
GGCGACCAGTTGCACCGACATGGCGCTTTTTGCGCGGATGAAGGCCTATCTTTGGCGCGATGTCCTGGTCCTTAAAAACGGCCTGCCGAGCCACGATACG
TTCAGCCGGGTGTTCCGGATGCTCGATCCGAAGGCGTTCGAGAGCGCGTTTCGGCAATTCATGAAGGCCTTTGCGCAGGGCGCCAAAATCAAGCGGCCGC
GCGGCGTGATCGCGCTCGACGGCAAAGCGTTGCGACGCGGCTACGACCGCGGCAAGAGCCACATGCCGCCGGTCATGGTGACCGCCTGGGCGGCGCAGAC
GCGCATGGCGCTGGCCAATGTGTTGGCACCGAACAACAACGAGGTCGACGGCGCCTTGCAGCTGCTTGCGCTGCTGCAGCTCAAGGGCTGTGTCGTGACC
GCCGATGCCCTGCATTGCCACCGGGCAATGGCCGATGCGATCGTGACCCGAGGAGGCGATTACGTCCTGGCGGTGAAGGCGAACCAGCCTGCTCTGTTGG
AGGATGCCAAAGCTGCGATCCGCGCCGCCAAACACAGCGGCAAGACGTCGCTCACCACCACAGACGCCGACCACGGCCGCAACGAGAGGCGCGTTGCCCT
CGTTGCGCCGGCTCCCGGCATGGCCAAGAAACACGACTTCCCCGGTCTCAAAGCGGTTGCCCGCATCACCAGCAAGCGCGGCCAGGACGACACGGTCGAG
CGCTACTTCCTGATGAGCCGCCCCTACAGCCGCAAAGACGTCCTGCGCATCGTCCGGACCCATTGGTCCATCGAGAACGGCCTCCACTGGCCGCTCGACG
TGACCCTCGACGAGGACCTTGCCCGCAACCGCAAGGACAATGGACCGGCCAATTTGGCTGTGCTCCGGCGCCTCGCCCTCAACGTCGCCAGAGCCCACAC
CGACACATCCGTCTCTCTTCGCGGCAAGCTCAAGCGTGCCGGCTGGAACGACGCCTTCCTCTTCGAACTCCTCGGCCACATGCGATAGCCCTG
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
1098 bp365 aa911188+No
ORF function : Transposase
Chemistry : Unknow

ORF sequence :

MERFAECFSELPDPRADNALHDLTEILFIALMATLCGATSCTDMALFARMKAYLWRDVLVLKNGLPSHDTFSRVFRMLDPKAFESAFRQFMKAFAQGAKI
KRPRGVIALDGKALRRGYDRGKSHMPPVMVTAWAAQTRMALANVLAPNNNEVDGALQLLALLQLKGCVVTADALHCHRAMADAIVTRGGDYVLAVKANQP
ALLEDAKAAIRAAKHSGKTSLTTTDADHGRNERRVALVAPAPGMAKKHDFPGLKAVARITSKRGQDDTVERYFLMSRPYSRKDVLRIVRTHWSIENGLHW
PLDVTLDEDLARNRKDNGPANLAVLRRLALNVARAHTDTSVSLRGKLKRAGWNDAFLFELLGHMR

 

Blast result :
Comments
ISRpa6 is 88% aa similar to ISRpa5.
References
1] Copeland,A., Lucas,S., Lapidus,A., Barry,K., Detter,J.C., Glavina del Rio,T., Hammon,N., Israni,S., Dalin,E., Tice,H., Pitluck,S., Chain,P., Malfatti,S., Shin,M., Vergez,L., Schmutz,J., Larimer,F., Land,M., Hauser,L., Pelletier,D.A., Kyrpides,N., Anderson,I., Oda,Y., Harwood,C.S. and Richardson,P. (2006) Direct submission GenBank.