ISPsp4

  • Family IS30
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
AB094786 ND Pseudomonas sp.
Pseudomonas sp. K23
DNA section
IS Length : 1084 bp

Ends


IR Length : 13

IRL : CTGAGTGCAACACCTGACCTTTCCGGTACGGTGCTGCCCTATGTCTTATT
IRR : CTGAGTGCAACACGGTTATTGAATTGACGCAGGAGCATCATATTGCATAG

Insertion site


Left flankDirect repeatRight flankDR Length
GGCGGCAAAAACTCCTGCAACCGCCATG0

DNA sequence

CTGAGTGCAACACCTGACCTTTCCGGTACGGTGCTGCCCTATGTCTTATTCCGAACTCAGCGTTGAAGAGCGTGCCACCATTCAAGTTAGTCATGCCCAA
GGCCTCAGCTTGCGCAGGATTGCCTGCTTGATCAACCGATCCCCTTCGACGGTCAGCCGGGAGATGCGCCGCAATCGAGATGCAGCTGGCAGCTACTCGG
CCCGTGTGGCTCAGCAGCGGATGAAGGCCCGCCGCCAGGCTTGTCGGCCCATGCGAAAGCTGCTGCCAGGGAGTGAGCGCTTTGAACTGGTGATCCATAT
GCTGCGCCAGCGTTTGTCTCCCGAGCAGATTGCCGGCAAGCTGCGCAGTATGAACATACCCAGCCTTAGAGATGCCTACGTCTGTCGCGAGACGATCTAC
AACGCGATCTATGCCCTGCCCGTCGGTGAGCTGCGCAAGGAGTTGATCCTTTGTTTGCGCCAAGGCAAGACGACACGTAGACCACGCCTTGGCGGTGTGG
ATCGGCGCGGGCAGATTCCAGAGATGGTCAGCATTCACTTGCGCCCGCCGGAAGTTGAAGACCGGCTGATGCCGGGGCATTGGGAAGGCGACCTTATTAA
GGGTAAGGCTAACGCCTCGTCTGTAGGTACGCTGGTGGAGCGCACTAGTGGTTACCTGATGCTGGTGAAGATGAACGACGCGACGGCGACCTCGGCGATG
GAGGGCTTCAGCGCCGCCCTCAATAACATGCCGCTGGCGATGCGCAAGAGCATGACCTACGACCAGGGCCGGGAAATGGCACAGCACGCCGAGATCACCC
AGAGAACCGGTGTGGCGATCTACTTCTGCGACCCGCACAGCCCTTGGCAGCGCGGCAGCAACGAAAACATTAATGGCCTGATCCGCCAGTACCTGCCCAA
GGGCACTGACTTGTCGGTACATAGCCAAGAAGAACTGGATGCCATTGCGTTTCAACTGAACATGCGTCCACGTAAGCGCTTCGATTTCAAATGTCCTATC
GAAGTCATGAGCGAAGTGATGCAGAAAGCCTTGGCTATGCAATATGATGCTCCTGCGTCAATTCAATAACCGTGTTGCACTCAG
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
1029 bp342 aa411069+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MSYSELSVEERATIQVSHAQGLSLRRIACLINRSPSTVSREMRRNRDAAGSYSARVAQQRMKARRQACRPMRKLLPGSERFELVIHMLRQRLSPEQIAGK
LRSMNIPSLRDAYVCRETIYNAIYALPVGELRKELILCLRQGKTTRRPRLGGVDRRGQIPEMVSIHLRPPEVEDRLMPGHWEGDLIKGKANASSVGTLVE
RTSGYLMLVKMNDATATSAMEGFSAALNNMPLAMRKSMTYDQGREMAQHAEITQRTGVAIYFCDPHSPWQRGSNENINGLIRQYLPKGTDLSVHSQEELD
AIAFQLNMRPRKRFDFKCPIEVMSEVMQKALAMQYDAPASIQ

 

Blast result :
Comments
ISPsp4 is 95% aa similar to ISPfl2.
References
1] Inoue,K., Widada,J., Nakai,S., Endoh,T., Urata,M., Ashikawa,Y., Shintani,M., Saiki,Y., Yoshida,T., Habe,H., Omori,T. and Nojiri,H.(2004) Biosci. Biotechnol. Biochem. 68 (7), 1467-1480