ISHar7

  • Family IS3
  • Group IS51
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
NC_009138 ND Herminiimonas arsenicoxydans
Herminiimonas arsenicoxydans
Janthinobacterium sp
DNA section
IS Length : 982 bp

Ends


IR Length : 25/26

IRL : TGGAGTTACCAGGATTTAGTAGACAGGAGTAGCATTCGACCTGTAACTAA
IRR : TGGAGTTACCAGCATTTAGTAGACAGCTGATTTCCGTCTACGATGTGCGG

Insertion site


Left flankDirect repeatRight flankDR Length
AAACTCGGAGTAGGACTTAA0
AACTATCGGGCTGTACCTCT0

DNA sequence

TGGAGTTACCAGGATTTAGTAGACAGGAGTAGCATTCGACCTGTAACTAAAGGTGGTGACCATGTCCAAAATCAAGGCCTCCAGCAAGGTAAGGCAAGCA
TATAAATTTATTGAATCGCATCGTGACGAATTCAGTGTAATCAGCATGTGCCAGGCTCTCGATGTTGAACGATCAGGTTACTACGCGTGGTTGAAGAATC
CCTTGTCTGATCGCGCACAGGAAGATGCTCGGCTTCTTAAGCTGATCAGAGCATCCTTCATGGCAAGTCATGGCATCTATGGTGCCCCGAGAGTCTTCCA
AGATCTAAGGGAGCGCGGGGAACTATGCAGTAAGCACAGAGTAGCCCGTCTTATGCGAGAAAATGGGTTGCGAGCGCTGCATGGCTATCGCATACGGCAT
ATACCCGTCTCAAAGCCATCACCACTGATCCCCAATTTACTCCAACGGCAATTTACGGTTACGCGGCCAAACGAAGCATGGGTAACTGACATTACCTATA
TCCGAACGTGGCAGGGCTGGCTTTATCTCGCCGTGGTGATGGATTTATTCTCAAGAAAGGTCGTTGGCTGGGCTGTTCGACCTACCATTCATCGCGAATT
AGTACTCGATGCCATTGCCAAAGCAGTGCGCAGCCGCCGCCCTCGCCATACCTTGATTCATTCAGACCAAGGAACGCAATACGGCAGCGACGCCTGGCGA
CGGTTCTGCAAGGCTAATCATCTGGAGCCGAGTATGAGTCGGCGGGCAAATTGCTGGGATAACGCAGTGGTAGAGTCCTTCTTCAGCAGTTTAAAGAAAG
AGCGCGTCAAAAAGCACATTTATGCTGATCGCGAAACCGCTACACTGGACCTAGCCGAATACATTGATGACTTCTACAATGGGGTAAGACGACACAGTCA
TCTTGGTGGTGTCAGTCCGAATACGTTTGAAACCGCACATCGTAGACGGAAATCAGCTGTCTACTAAATGCTGGTAACTCCA
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
906 bp301 aa62967+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MSKIKASSKVRQAYKFIESHRDEFSVISMCQALDVERSGYYAWLKNPLSDRAQEDARLLKLIRASFMASHGIYGAPRVFQDLRERGELCSKHRVARLMRE
NGLRALHGYRIRHIPVSKPSPLIPNLLQRQFTVTRPNEAWVTDITYIRTWQGWLYLAVVMDLFSRKVVGWAVRPTIHRELVLDAIAKAVRSRRPRHTLIH
SDQGTQYGSDAWRRFCKANHLEPSMSRRANCWDNAVVESFFSSLKKERVKKHIYADRETATLDLAEYIDDFYNGVRRHSHLGGVSPNTFETAHRRRKSAV
Y

 

Blast result :
Comments
ISHar7 is 77% aa similar to ISEc15 (ORFAB).
There is no programmed -1 frameshift. It seems that there is no ORFA, but there are two copies in Herminiimonas arsenicoxydans and 1 copy in Janthinobacterium sp.
References
1] Muller,D., Medigue,C., Koechler,S., Barbe,V., Barakat,M., Talla,E.,Bonnefoy,V., Krin,E., Arsene-Ploetze,F., Carapito,C., Chandler,M., Cournoyer,B., Cruveiller,S., Dossat,C., Duval,S., Heymann,M., Leize,E., Lieutaud,A., Lievremont,D., Makita,Y., Mangenot,S., Nitschke,W., Ortet,P., Perdrial,N., Schoepp,B., Siguier,P., Simeonova,D.D., Rouy,Z., Segurens,B., Turlin,E., Vallenet,D., Van Dorsselaer,A., Weiss,S., Weissenbach,J., Lett,M.C., Danchin,A. and Bertin,P.N. (2007) PLoS Genet. 3 (4), E53