ISPpr13

  • Family IS200/IS605
  • Group IS200
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
NC_006371 ND Photobacterium profundum
Photobacterium profundum SS9 chromosome 2
DNA section
IS Length : 596 bp

Ends


Left end : TCGTCACCTAAAAGGTTAAAACCACCGACTTTAGTCGGTCAGCTTCAGCTATGATATTTTACGGTCATCGATGATGTTGGAGCATGATTATGGATTATAG II struct. : Yes
Right end : TAACTTCAGGACAGAAGGCTAACGAAAACGGGTCTTTGACCCGTATCCGGACTTTCAGTCCTTAATACTAACCCACCTACTTTAGTAGGTGGTTGTTTAG II struct. : Yes

Insertion site


Left flankLE cleavage siteRight flankRE cleavage site
ACAGCAGTGGCCTTTTTTATTCTTACTGAAAGCGTTAG
CCTACGTACTCACTGTTTATTCACAAAGCCAACCttag
TTAATGATCAAATTATTTATTAGCTAGAAATTTATTAG

DNA sequence

TCGTCACCTAAAAGGTTAAAACCACCGACTTTAGTCGGTCAGCTTCAGCTATGATATTTTACGGTCATCGATGATGTTGGAGCATGATTATGGATTATAG
ATATGGAAGTCATACAGTCTTCAAAATTCAGTACCATTTCGTTTTTGTAACGAAGTATCGTTATCAAGTTTTGACTGGTGATGTTGGCTTGAAAGCTCGA
GAGCTAATCAGGCAAACATGTCATGCTTTTGAGATTGATATTTTGAAGGGGGTAATCAGTAAAGATCATGTTCACTTGTTAGTTTCTGCACCACCCAATA
TGGCACCTAGCGAAATAATGCGAAGGATTAAAGGCCGTACATCGGCTAAGTTGTTCGAGAGTTATCCTGATTTAAAGAAGAAATACTGGGGACGTCATTT
TTGGGCTAGAGGCTACTTTTGTGTGACATCTGGTGACCTAACGGAAGAAATGATAAAGGAATACCTTGATCATCACTTTGAGCCCAAGGCTGAAGATAAC
TTCAGGACAGAAGGCTAACGAAAACGGGTCTTTGACCCGTATCCGGACTTTCAGTCCTTAATACTAACCCACCTACTTTAGTAGGTGGTTGTTTAG
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
435 bp144 aa84518+No
ORF function : Transposase
Chemistry : Y1

ORF sequence :

MIMDYRYGSHTVFKIQYHFVFVTKYRYQVLTGDVGLKARELIRQTCHAFEIDILKGVISKDHVHLLVSAPPNMAPSEIMRRIKGRTSAKLFESYPDLKKK
YWGRHFWARGYFCVTSGDLTEEMIKEYLDHHFEPKAEDNFRTEG

 

Blast result :
Comments
ISPpr13 is 87% aa similar to ISPlu2.
References
1] Vezzi,A., Campanaro,S., D'Angelo,M., Simonato,F., Vitulo,N., Lauro,F.M., Cestaro,A., Malacrida,G., Simionati,B., Cannata,N., Romualdi,C., Bartlett,D.H. and Valle,G.(2005) Science 307 (5714), 1459-1461