ISHne3

  • Family IS110
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
NC_008358 ND Hyphomonas neptunium
Hyphomonas neptunium ATCC 15444
DNA section
IS Length : 1172 bp

Ends


Left end : TAGGGCCCACAAGCACAACGCCACTTACCCCTTGTATGTCATCTTTTGCCCGGCCTGCTATATTTCCGCGGTCGGCAGCGGATGAGAGCACCCCACCCCT
Right end : ACTTCTCACAATCCTCAATGCAATCCTCAGAGACAAATCCCCATGGCAAACACAAAACGCTTGAAAGCGAACACAGTCGCTCTCCCGCTTGCGGGAGAGG

Insertion site


Left flankDirect repeatRight flankDR Length
AGCGGCCGAAAGGGGCCCAT0

DNA sequence

TAGGGCCCACAAGCACAACGCCACTTACCCCTTGTATGTCATCTTTTGCCCGGCCTGCTATATTTCCGCGGTCGGCAGCGGATGAGAGCACCCCACCCCT
GAGGGACACCAAGCCCGTGGGAGAGCGTGTCGCCTCATCCGCCTTGGTCATCAACCCGGACAGTCGCTTGGGCCGGCGAAAGCGAAGCCCGCATGCGCAA
GGTCGGGACATGAGCGAGAGATTTGTTGGAATTGATGTGTCGAAGGAGACATTGGACGTCCATGTATTGCCGGAGGGGCGTGCCTTTGCCGTCGCGCGCA
CAGACAGCCTTCTGGCCGCGTTGTCGGAGCTGGGCGCGGACCTGGTGGTGCTGGAGGCCACCGGCGGGCTGGAACGGGTGGTCACCGCCGCCCTGGCCGG
GGCGCAGATCCCGGTTGTTGCGGTCAATCCCCGTCAGATCCGGGACTTTGCCCGCGCCACCGGGCAGCTGGCCAAGACGGATGCGATCGATGCGGCGGTA
ATCGCCCGGTTCGGACAGGCGATCCGGCCGGCCCCGCGAGCCCTTCCGGACGCCGCGGCCCAACAGTTGGCAGAGCTGGTCACCCGGCGGCGGCAGGTCA
TCGACATGGCGGTGGCCGAACGCAACCGCCGCCGCCTGGTGACGGCCAGGCCGGCCCTGCGCAGCATCGACCGGGTGCTGAAGGTTCTGGAAGCCCAGCT
GGCAGACATCGACAGGGAGATCGGGGACCGCATCCATGCCAGCCCGGCCTGGCGGGAGGCAGAGGACCTGCTCAAATCCGTACCCGGCGTTGGCGACCAG
ACGGCCCGCACCCTGATTGCGGCCCTCCCGGAACTAGGCACCCTTAGCCGCCGTCAGATCGCGGCCCTCGCGGGGCTTGCCCCCTTCAACCGCGACAGTG
GCCAGTGGCGCGGCCGCCGCTCCATAACCGGCGGCCGCGCCGATGTGCGCAGCGTCCTCTACATGGCTGCCCTGGCCGGCATCAGGTTCAACCCAGCCCT
GAAAGCCTGCTACCAGCGCCTCCGGACAGCCGGAAAGCCCGCCAAGGTCGCCCTCGTGGCCGTCATGCGAAAACTTCTCACAATCCTCAATGCAATCCTC
AGAGACAAATCCCCATGGCAAACACAAAACGCTTGAAAGCGAACACAGTCGCTCTCCCGCTTGCGGGAGAGG
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
927 bp308 aa2101136+No
ORF function : Transposase
Chemistry : DEDD

ORF sequence :

MSERFVGIDVSKETLDVHVLPEGRAFAVARTDSLLAALSELGADLVVLEATGGLERVVTAALAGAQIPVVAVNPRQIRDFARATGQLAKTDAIDAAVIAR
FGQAIRPAPRALPDAAAQQLAELVTRRRQVIDMAVAERNRRRLVTARPALRSIDRVLKVLEAQLADIDREIGDRIHASPAWREAEDLLKSVPGVGDQTAR
TLIAALPELGTLSRRQIAALAGLAPFNRDSGQWRGRRSITGGRADVRSVLYMAALAGIRFNPALKACYQRLRTAGKPAKVALVAVMRKLLTILNAILRDK
SPWQTQNA

 

Blast result :
Comments
ISHne3 is 70% aa similar to ISGme8.
References
1]Badger,J.H., Hoover,T.R., Brun,Y.V., Weiner,R.M., Laub,M.T., Alexandre,G., Mrazek,J., Ren,Q., Paulsen,I.T., Nelson,K.E., Khouri,H.M., Radune,D., Sosa,J., Dodson,R.J., Sullivan,S.A., Rosovitz,M.J., Madupu,R., Brinkac,L.M., Durkin,A.S., Daugherty,S.C., Kothari,S.P., Giglio,M.G., Zhou,L., Haft,D.H., Selengut,J.D., Davidsen,T.M., Yang,Q., Zafar,N. and Ward,N.L.(2006)J. Bacteriol. 188 (19), 6841-6850.