ISPaac1

  • Family IS256
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
NC_015702 ND Parachlamydia acanthamoebae
Parachlamydia acanthamoebae UV-7
DNA section
IS Length : 1397 bp

Ends


IR Length : 18/21

IRL : GAGATATGATCAAAAGTTGTGCATGAGGTGAAAAAAAGAGAGCGCATCCT
IRR : GAGATATTGTCAAATGTTGTGTTTTGAGCATCTAATAGCGCATCCAATTT

Insertion site


Left flankDirect repeatRight flankDR Length
ATACCCTTTATTGTTACGTGA0
TAATCGACCTGTTAAAGCTCCTAGCATATTG9
CCAAATCCCCTGTATAGCCAT0
TTTTTAGGCTCAATAGATAAT0

DNA sequence

GAGATATGATCAAAAGTTGTGCATGAGGTGAAAAAAAGAGAGCGCATCCTTAAAATGTTTTTTACGACAAAAACTAAATGGGAGTGCGCTCATGGAAGAT
TTTCGCTTTTCTTCAGAAAAAATGCCATCAACAAATGAACAAAATAATCCTCTCGAAGAAATTCTTCGTAAAGGGGCTCAAAAATTGTTACAGCAAGCTA
TTGAATTTGAAGTACAAGAATATCTGGAACTTTACAAACAATCGAAAGAATCTACCCATCAATCTCCTGCAGTAAGAAATGGTTACTTACCAGAAAAAAA
CATTCAAACCGGTCTTGGCCCAATTGCAATTCGCCAGCCTAGAATAAGACATAGAGACAATGGCAAGTTCACAAGTGCGATTTTGCCACCTTATTTGAGA
AGGACACAAAGTATAGATGCGGTTATTCCTGCTTTGTATCTTAAAGGAATATCCACCCTGGATTTTCCGAAAGCTCTAGAGGCAATTTTGGGAGAAAATG
CTAAAGGACTATCACCCACAAATATCGTTAGATTGAAAGATTCATGGACAACAGAATATCAAAATTGGCTCAAAAGTGATTTATCCGCAAAAAAGTATGT
TTATATATGGGCGGATGGGATTTATTTTAACATTCGTTTAGAAGAAGATCGACCCTGCGTTCTGGTTCTGATAGGTGCTTTAGAGAATGGAAATAAAGAA
CTTATCATGATCCATGATGGGCACCGAGAAAGCAAGCAGTCTTGGAAAGAAGTTTTGCAAAATTTAAAACATCGAGGTCTCAAAGAAGGACCAAAGCTTG
CTATTGGAGATGGAGCACTTGGCTTTTGGGCAGCTTTAAATGAAGAGTTTCCAGCAACAAAGCAGCAAAGGTGTTGGGTGCATAAAACGGCTAATATTTT
AGATAAAATGCCAAAAAGTATTCAAAAGTATGCCAAAGAGATCATTCACGAAATTTATATGGCTCCAAGAAAAACGGATGGACTAAAAGCTTTTGAGAAG
TTTCTTGGAACATATGAATCAAAATATCCAAAGGCCTGTGAATGTTTGAAAAAAGACAAAGATCAATTATTTAGCTTTTATGATTTTCCAGGCATGCATT
GGCAACATATAAGAACAACGAATCCAATCGAATCAACATTTGCAACTATTAGGCACCGCACACGACAAACCAAAGGCTGTGGGTCCAGAACAGCCACACT
TGCCATGGTTTACAAGCTTTCAATGGAAGCGCAAAAGCGATGGCGAAAATTAAAAGGTCATGAGTTGATTAACAAACTGATTTTGGGTGTGCAGTTTAAA
GATGGGGAAGAAGTCTTTAACATGAAATACACAGCTTAATTTTTAAAAAATTGGATGCGCTATTAGATGCTCAAAACACAACATTTGACAATATCTC
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
1248 bp415 aa921339+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MEDFRFSSEKMPSTNEQNNPLEEILRKGAQKLLQQAIEFEVQEYLELYKQSKESTHQSPAVRNGYLPEKNIQTGLGPIAIRQPRIRHRDNGKFTSAILPP
YLRRTQSIDAVIPALYLKGISTLDFPKALEAILGENAKGLSPTNIVRLKDSWTTEYQNWLKSDLSAKKYVYIWADGIYFNIRLEEDRPCVLVLIGALENG
NKELIMIHDGHRESKQSWKEVLQNLKHRGLKEGPKLAIGDGALGFWAALNEEFPATKQQRCWVHKTANILDKMPKSIQKYAKEIIHEIYMAPRKTDGLKA
FEKFLGTYESKYPKACECLKKDKDQLFSFYDFPGMHWQHIRTTNPIESTFATIRHRTRQTKGCGSRTATLAMVYKLSMEAQKRWRKLKGHELINKLILGV
QFKDGEEVFNMKYTA

 

Blast result :
Comments
ISPaac1 is 70% aa similar to ISMdi13.
References
1] Romain Guérillot and Philippe Glaser (2013) Direct submission.
2] Collingro,A., Tischler,P., Weinmaier,T., Penz,T., Heinz,E., Brunham,R.C., Read,T.D., Bavoil,P.M., Sachse,K., Kahane,S., Friedman,M.G., Rattei,T., Myers,G.S. and Horn,M. (2011) Mol. Biol. Evol. 28 (12), 3253-3270.