ISArch14

  • Family IS66
  • Group ISBst12
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
AY714829 ND uncultured archaeon
uncultured archaeon GZfos19A5
DNA section
IS Length : 1560 bp

Ends


IR Length : 19/23

IRL : GTAACTACTCACCCCCTCGACCACAAAATTTATTATTAATAAGATTATAT
IRR : GTAACTACTCACCTACACAACCAACCGATGGAACAAACGGATCCCCTCTA

Insertion site


Left flankDirect repeatRight flankDR Length
AGATATTGAGCAATTACAAACAGTCTAA8

DNA sequence

GTAACTACTCACCCCCTCGACCACAAAATTTATTATTAATAAGATTATATTATCCATTGCAATCGTTGCAAATAAAATATTTCGTTTGATGGATGGAGAA
CGCGATGCACACACCCAACCGTGATGAAATTCATGCTGCTTACCAGCAAGGGGAAGAAGTAATCGTTCAACTATTTGATCAGTTTATTCATGAATTACAA
ACCCTGCAGGATCAGCTGCAAGCCCTGCAAGACCAACTGAACAAAAACAGTAAAAACAGCAGCAAGCCCCCTTCCAGCGATGGTCTCAAGAAGCCCCGCA
CCAGAAGCCAGAGGAAACCGGGCAACAGAAAGAACGGCGGGCAGGAGGGGCATGTTGGTCACACCCTAGAACCGGTGGAAGAACCGGATCACATAGAAGT
GCACGAGGTCGAGCAATGCACCGAGTGCGGTGCAACACTCACCGATGTCGAAGCGGAGGACTGCCAGAGACGGCAGGTCTTTGACATTCCGCCCATACAA
ATCGAAGTGACCGAACATCAAGCAGAGATCAAGACGTGTCCCCATTGCGGGCACACGAACATGGCTTCATTTCCACCAGATGTCACCGCATCGGTGCAAT
ACGGTAGCCGCATCAGATCGATGGCGATCTACATAAACAATTACCAGTTTGTCCCGCTGGAGCGTATCAGCGACTTTTTCGAGGATATTTTTGGTCATCG
TCCTTCTGAAGCGATCATCCTTCAGGCAAATGCGACCTGTGCAGAGAACGTAAAACCAGCCAATGATGCGATTAAAGAGCAGTTGACAAACGCTCATGTA
GTTAATTTCGATGAAACCGGTTTGCGAGTGGAGGGTAAGCTGAACTGGCTGCATGTTGCCAGCACTCACGATTTGACGTATTATACTGTGCATCCGAAGC
GTGGTAAGGAGGCGATGGACGCGATGGGGATTTTATCAGAATTCGGAGGAGTTGCTGTGCACGATCACTGGAGCCCCTATTTCAATTACACTGACGTAAT
ACACGGGCTTTGCAACGCCCATCACCTGAGAGACCTTACATTTATTCACGAACAGTATGAGCAGGACTGGGCAGAAGAAATGAGCCAATGCTTGCTTGAT
ATCAAGAAAGAGGTGGATCAAGCTAGCCTGTATAAGGATCAACTTGATTCTGAGGAGATCGAGGAGTTTGAAGTGCGTTATGATGAGATTATTGCGGAGG
GACTGGAACTAAACCCACCACCTCCGAAAGAACATGGAAAACGGGGCAGGATCAAACAATCTCCGCCCAAAAATCTACTTGACAGGTTATCGGAACACAA
ACAGGAAGTACTGGCATTTATGTACGACTTTGATGTGCCGTTTGACAATAACCAGGCTGAGCGGGACGTACGCATGATGAAACTGAGGCAGAAGATATCA
GGCACCTTCCGGACTGCTGTGGGGGCAGATATATTTTGCAACATTCGCGGGTATATATCCACAGCGCGGAAGAACGGGTATCATGTGCTCGATGCGATTC
AGGATGCGCTTAGAGGGGATCCGTTTGTTCCATCGGTTGGTTGTGTAGGTGAGTAGTTAC
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
1464 bp487 aa931556+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MENAMHTPNRDEIHAAYQQGEEVIVQLFDQFIHELQTLQDQLQALQDQLNKNSKNSSKPPSSDGLKKPRTRSQRKPGNRKNGGQEGHVGHTLEPVEEPDH
IEVHEVEQCTECGATLTDVEAEDCQRRQVFDIPPIQIEVTEHQAEIKTCPHCGHTNMASFPPDVTASVQYGSRIRSMAIYINNYQFVPLERISDFFEDIF
GHRPSEAIILQANATCAENVKPANDAIKEQLTNAHVVNFDETGLRVEGKLNWLHVASTHDLTYYTVHPKRGKEAMDAMGILSEFGGVAVHDHWSPYFNYT
DVIHGLCNAHHLRDLTFIHEQYEQDWAEEMSQCLLDIKKEVDQASLYKDQLDSEEIEEFEVRYDEIIAEGLELNPPPPKEHGKRGRIKQSPPKNLLDRLS
EHKQEVLAFMYDFDVPFDNNQAERDVRMMKLRQKISGTFRTAVGADIFCNIRGYISTARKNGYHVLDAIQDALRGDPFVPSVGCVGE

 

Blast result :
Comments
ISArch14 is 67% aa similar to ISMma14.
References
1] Hallam,S.J., Putnam,N., Preston,C.M., Detter,J.C., Rokhsar,D., Richardson,P.M. and DeLong,E.F. (2004) Science 305 (5689), 1457-1462.

2] Hallam,S.J., Preston,C.M. and DeLong,E.F.(2004) Direct Submission GenBank.

3] Putnam,N., Detter,J.C., Richardson,P.M. and Rokhsar,D. (2004) Direct Submission GenBank.

4] ISfinder annotation (2008).