ISRssp2

  • Family IS1595
  • Group ISNha5
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
ND Roseovarius sp.
Roseovarius sp. 217
DNA section
IS Length : 4633 bp

Ends


IR Length : 26

IRL : CGGCCTTATGTATCAAACGCACCAACCCGAGGGCTGAGCGATGATTAGCA
IRR : CGGCCTTATGTATCAAACGCACCAACAATCTAGGCAGCCGACTCATAAAA

Insertion site


Left flankDirect repeatRight flankDR Length
CGGATGTGGTTTTCATGGACATTTCCATGCCGGAAATGG8

DNA sequence

CGGCCTTATGTATCAAACGCACCAACCCGAGGGCTGAGCGATGATTAGCACATTGGCACTATGCGTTGCGGTTTCCATTTGTGATTTGGAAGATAGGAAC
AACAGCCATGTTTTCCCTGTTTATAGTTTTCACTCTGTGATTAACGCTTCCAAACTCGCGAATAACACCGTCATTCTTGAAAACCGTTTTGCTGGAAATA
CACACGTAAACCGTGAACGAAACGTACCCCTTCACCTCGAACGGCTCCGCGAAAAGAATATCGACATTCTTTTTGTCCCCGCTCGCAATATCACCAATCT
GCTTTGGCTTAGAAAAGAGGTCAACCGAGATATCCGCCTCCACTCTGACGTCAGTTACGCGGAGATTCACATTTCTGGCCGGAGAGTTACCGCTGTTGTG
GATAGTAAGCCTTACATAATTATGGCCTTCACGTCCGGGCCTTCCATTTCGGAAGTATTTTGCACCAGTGATACTAAGATATGCCCTAGTTTGCGCTTGG
CCGATTTCCCTGGTGTCAGTGGCCATTCTTTGGGTGGCCTTGAGGGTTTGCCAAACAAAGATTACACCAAGGCCAGTAATCAAGGCCACTATTACAGTGG
CTACAAGCATCCAAAAAGCCCACAGGGCCATTTCCGTTTGGGCCTCAAGGTCATCCTGAGCGCGTTGGTCCTCGTTGGTGGAGTTTATAATTTCGGCTAC
GCATTTAGAAAAATTGGACAGGTCACTAATGAGGCAGGATTGCTCTATTTGATTAGTGGCATGTGCGGCATAGCGGCTGGTGTGATAGGCATTCTTGGCT
TTGGTTTCGCCCAATTTTAGACCAGTAGCATAGACGCCCCATCCAATCGCTAAAATTACTGCTAGTCCAAGTGTAACTGATATGATCCAATAGCGTTTAG
GCATTGCAACATAAACGCCGCCGAAAACTTCCCTCGGGATAGCTTGTTGCGGACGTTCACTTCCTTTTCACTGATTCCAATATTTGCCAGCTTTTCAACT
AGCTGAGCATAAGTCACGCCTTTCCGCTTCAGCTCTGCTTTTAGAAGGTTTGCGGCCTTCATTTCCCATTCCGTTTGTGTCGGCATGTATCACCTTTATG
TTTAAAAGTATCATATTTATTACTTATGCCCTTGCATGGGATACGTCAACGCACTATATACGTTACATAAGAAACGGATGTAGTGACAATGGCCCAGCAT
TTTCTTCTCTCAGCAGCATCACGCACACTCAGCCTTCGCCAGATCTACAAGGCAGGCGAAGACGCGGCTTACCAGACGTTCTGCGAAATGCGCTGGTCTG
AGACAAATGGCGAGGCAGTTTGCCCGCGGTGTTCGAACCATGAGACCTACAAGATCACCACGCGCCGCAAGTTTAAGTGCAAGGCATGCGCGCACCAATT
CAGCGTGACGAGCGGCACGATCTTTGCCAGCCGCAAGATGGATTTTGTAGACCTTCTGGCCGCGATCTGCATCATCGTGAATGGGGCCAAGGGCGTTTCC
ATGATCCAGCTTTCCCGCGATCTGGACTGCCAATACAAGACCGCTTTCGTTCTGGCGCACAAACTGCGCGAGGCAATGGCGCAAGAGGTCCAGACAGGCG
AAGTGCTGCAAGGCCACGTCGAGATTGATGGCGCATACTTTGGCGGCCATATTCGCCCTGAGAACGCCAAGGCAGACCGCAAGGACCGCCGCTTGAAAGC
ACACCAGACCGGCAAGCGCCGCGTGGTTATCGCCATGCGTGAGCGCACTGGCCGCACCCTGCCCGTTGTAGGCATGTCTGAGGCCGAAGGCGTTGCACTG
GCAAACGAGAACGTGTGCCGCATGGCCACCATGTCAGCCGATGAGGCAAGCCATTGGGATGAGTTGCACATGGGCTGGTCGGTTGACCGCGTGAACCACA
GTGAGATTTACAGCGACCACGGCAAGCACACCAACATGGTTGAAAGCTATTTCTCGCGCCTGCGCCGCATGGTGACAGGCCAGCATCACCACGTTAGCCC
GCAATACCTTTACCAGTATGCGAACCACGCTGCATGGCTTGAGGACAACCGTCGCTTTGACAACGGCGAACTGGCACACCGTCTGGTGTCTAACGCAATG
GACGCGCCAGTTAGCCGTAATTGGAAAGGGTATTGGCAGCGCGCGGCTTAATGTTCACGCTGCCATTTTATATTCTGACACATCGAGCGTCACGTTGTCG
CTTTCTGACAACTTATAAGCTTTCTTGTACGCAGACCTCTTCGCGTTATCCGAAATTAGGGCATCGCCAAATTGGGAAACAAGAGCAATGAAGATGTCAC
GGACATGAACGAAGTCACTGTCGGTGAGTTGAAGCGTGGGCTTTATTTTTTTAAGAAATACGTTCTTCAAGCCCTTTAGCCGGAAACCCACCATCTCCCC
GTCTTCATCATAAGTTATTGTCAAAAACTGATCTATACGATCCGAAATTGTAAGGGTATCCCGTTGTACATAGTCGATGTAATCCATGCTGGGGAAATAC
ACGGCTACTTTAGAAAACTCCTTGCCTTCAACGGGCTGGAAGTCCGTCGATTCAACATGTTTTGTCATTACAGCCTCCAAACTTGCACCTTGTATCTGAC
TTCTGCCTCATAAGGAACGGTTGGCGCGTTTTCGTCGTTCTTTACCCATTCCCACGAAAGGATCATACCACTTGAGCCAGCAGATGTCTCTTGCTTATAA
CGACGAACATAGCAAGCGAAAACGGCATTTTTAGGACTTGGGCATGATTTTGCAACGCAAACCATATGCGGTACATACCTATAGAAAGTACTCGGGCTGG
ATATAAAAACATACACCTCTTCTCCATTGTCGGACCCATCAATTGGTCGCTCCAATCCACGGTAAACCGCATGAGAGGCCAGCATACCTTTCAGAACAAC
CTTTCTGCCATCTTCGTGATATCCAATATTGTTTACGGGCGGCGCGCACCCTTTAACACACGTCCAAAAATCCATTAAGGATTGTCGGCGCAAGTGGATT
GCGTTTTGCTTCACCCAAGATGCTGAAACATCAAGCTTCATCATTTCATTTTGATCATCAAAATGAGGTGCCGCAATTGTGTAATCTTCTATCTCAGCGA
AAACCATGCTCGATTATTCCTTGTTGATGGGGTTATCGAGCATTGACTGTTTGTCCATTCTGTGGGACATATGTTGTGTGTTTGCGTTGCTCGACAACGT
GGTTTAGAGGGGGTCCGCTAGAATTAGCGTGACCCCTTCCTTTTGACCATAGGGCATGTGCCGCTCAGAGTCCATAGAAGGGCAACTGGAGTTGCGTCTT
TTAAATTCGGGGAATGGGTAGTCAAAAAAAGAAATCGGCACTGTGCGGGCCTCTCTGGCTCTCATATGGGAAATTGCGAAGTTCCCCATAGCGCTCCGTT
ACGTTCCACCCAGCCTTTGCGCCGCAGATTGTGCAGCGCCTGATACATGCGCCCGCGCGCTTCCTCATAGGTCATATCAGTGACTGATGCGGCATAGAGC
GACACTTCCTTGCCAGTCTTAGGACCGCTGCGCAGAGCGTCCATTGCCAGTATCGACGTATCACGCCTCTGAGCGATCTTGCGGGGAACTGCATGCGCAG
ACAGATCAACACCGCGCATCACAAGCAACGCCTCTACATGCTCCAGACCGTCTAGGCTGTCGCGGATCATCTGCGCTCGAAGGTGCAGCAATGCGTTTGT
GACTGTCTTATCCAACATACCCGCATTGTGATTCACATGGGCGCGAAAATCAGCTAGGCAGCACACTCATTAATTCTTGTTTAGAAGCATAAGTTTGTGA
TTCACTCTCGCACAAAACTGGGCGGGAGAATGCAAATGGCGCGATCAGATATGAGCGATCTGGAATGGGAGTTCATCAAAGCTGTCTTGCCCAACAAAAC
ACGTGGCAAGAAGCGGGTTGATGACCGCCGCGTGATCAACGGCATTTTCTACGTCCTGCGCACCGGCATCCCTTGGGCTGATCTACCAGAGCAATACGGC
CCACCGACCACGGTCTACAACCGCTTCAACCGGTGGAGCTATGCAGGCCACTGGGACCGGATCATGGAGGCCATCGCCGACGCGCATAACGTTGACATGG
TGATGGTCGACGGGACCAGCGTGCGTGCGCATCATTCCGCCACCACGCTCAAAAAAAGACCCACGCCGCTGTTTAGGTCGTTCACGGGGCGGATTAGGGA
CGAAAATACATGCACTTACCAATCAGGATGGGCTGCCGATCCGATATGAATTGACACCCGGTCAAGCCCATGACGCGCCGCCGTGCAAGACGCTACTGGA
CAACTTGCAACCTGGACAACATGTGCTCGCGGATAAAGCATATGACGCAGACTGGATCAGGGATATGATCTGGGAACAGGGGGCTATCGACGTGATCCCT
CCCAAGGCCAACCGTAAACTACCCGCCGAATTTGATGCTGAAATCTACCGGGAACGCAACAAAATCGAGCGCTTCTTTGGCAGGCTGAAAGCCTCGTTCC
GCCGTATCGCAACCCGATACGAGAAGACCTCACGCAATTTCCTGTCGATGATCAAACTGGCATCGATCAGGCTGTGGATCGAGTTTTATGAGTCGGCTGC
CTAGATTGTTGGTGCGTTTGATACATAAGGCCG
Protein section
ORF number : 6

 

ORF 1
LengthBeginEndStrandFusion ORF
756 bp251 aa81459-No
ORF function : Passenger Gene
Annotation : Hypothetical proteinDescription :

ORF sequence :

MGETKAKNAYHTSRYAAHATNQIEQSCLISDLSNFSKCVAEIINSTNEDQRAQDDLEAQTEMALWAFWMLVATVIVALITGLGVIFVWQTLKATQRMATD
TREIGQAQTRAYLSITGAKYFRNGRPGREGHNYVRLTIHNSGNSPARNVNLRVTDVRVEADISVDLFSKPKQIGDIASGDKKNVDILFAEPFEVKGYVSF
TVYVCISSKTVFKNDGVIREFGSVNHRVKTINRENMAVVPIFQITNGNRNA

 

Blast result :
ORF 2
LengthBeginEndStrandFusion ORF
201 bp66 aa1062862-No
ORF function : Passenger Gene
Annotation : Transcriptional regulator, XRE familyDescription : Transcriptional Regulator factor

ORF sequence :

MKAANLLKAELKRKGVTYAQLVEKLANIGISEKEVNVRNKLSRGKFSAAFMLQCLNAIGSYQLHLD

 

Blast result :
ORF 3
LengthBeginEndStrandFusion ORF
1023 bp320 aa11892211+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MAQHFLLSAASRTLSLRQIYKAGEDAAYQTFCEMRWSETNGEAVCPRCSNHETYKITTRRKFKCKACAHQFSVTSGTIFASRKMDFVDLLAAICIIVNGA
KGVSMIQLSRDLDCQYKTAFVLAHKLREAMAQEVQTGEVLQGHVEIDGAYFGGHIRPENAKADRKDRRLKAHQTGKRRVVIAMRERTGRTLPVVGMSEAE
GVALANENVCRMATMSADEASHWDELHMGWSVDRVNHSEIYSDHGKHTNMVESYFSRLRRMVTGQHHHVSPQYLYQYANHAAWLEDNRRFDNGELAHRLV
SNAMDAPVSRNWKGYWQRAA

 

Blast result :
ORF 4
LengthBeginEndStrandFusion ORF
363 bp137 aa25682206-No
ORF function : Passenger Gene
Annotation : Hypothetical proteinDescription :

ORF sequence :

MTKHVESTDFQPVEGKEFSKVAVYFPSMDYIDYVQRDTLTISDRIDQFLTITYDEDGEMVGFRLKGLKNVFLKKIKPTLQLTDSDFVHVRDIFIALVSQF
GDALISDNAKRSAYKKAYKLSESDNVTLDVSEYKMAA

 

Blast result :
ORF 5
LengthBeginEndStrandFusion ORF
210 bp69 aa28722663-No
ORF function : Passenger Gene
Annotation : Hypothetical proteinDescription :

ORF sequence :

MRFTVDWSDQLMGPTMEKRCMFLYPARVLSIGMYRIWFALQNHAQVLKMPFSLAMFVVISKRHLLAQVV

 

Blast result :
ORF 6
LengthBeginEndStrandFusion ORF
240 bp118 aa43644603+No
ORF function : Passenger Gene
Annotation : Hypothetical proteinDescription :

ORF sequence :

MLDKTVTNALLHLRAQMIRDSLDGLEHVEALLVMRGVDLSAHAVPRKIAQRRDTSILAMDALRSGPKTGKEVSLYAASVTDMTYEEARGRMYQALHNLRR
KGWVERNGALWGTSQFPI

 

Blast result :
Comments
The third ORF is the transposase, others are passengers genes.
ISRssp2 is 77% aa similar to ISAusp1.
References
1] Murrell,J.C., Schafer,H., Ferriera,S., Johnson,J., Kravitz,S., Halpern,A., Remington,K., Beeson,K., Tran,B., Rogers,Y.-H., Friedman,R. and Venter,J.C. (2006) Direct suibmission GenBank.