ISArch16

  • Family ISAzo13
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
AY714842 ND Uncultured archaeon
Uncultured archaeon GZfos26F9 clone GZfos26F9
DNA section
IS Length : 1312 bp

Ends


IR Length : 16/18

IRL : GGGCTTGCCAAGAAATAAGTTGATAAGTTTTATTAACTAAAAATGCACAT
IRR : GGGCTTGCCAGAAAATAACCTATCGATTTTTCAGTCACCATCCGGTTCCG

Insertion site


Left flankDirect repeatRight flankDR Length
CATTAGAATGAACTTAGTTATACGAAGGG3

DNA sequence

GGGCTTGCCAAGAAATAAGTTGATAAGTTTTATTAACTAAAAATGCACATATATCATCATGGATGATATAGAGAAGCATAAAAATTGGTTGAAAGTTTTG
GCATTGGCAGATGAGGCACTAAAACGTAAGTTGGCTGCGGCTAAAGCACTTGACTTAGGCTGGGGTGGGATCTCGACTGTCACAAGAATCACCGGCATGT
CCCCTACAACAATAAGAAAAGGAATCCACGAACTTGACAATCTGGAGAAGCTGGAACAACCAAAAAGAATTCGTAAAACTGGCGGTGGGCGAAAAAGGGC
TGACATCAAAAACCCGAAAATTGTTGAAGACCTTGAGGCAATTATGGACGAGAATACCGCAGGCGACCCAATGAGCTTTTTAAAATGGACGTGTAAATCA
ACATACAAGATAGCTGACGAATTGAATCTTCGAGGACACAAAATCAGTGCAGAAACCGTTAGACTGCTTTTAAGAGAACGGGATTACTCACTTCAAGCCA
ATGTGAAGACAAAAGAAGGAGGTTCTGAGCCAGAAAGAGACGCACAGTTCCGATACATAAACGAACAAGTGAAAAAAATTGTTGCGCAAGGCGACCCAGT
TATCTCGGTGGATACAAAGAAAAGAGAAATTGTAGGGGACTTCAAAAACCCTGGTAGAACATGGAGGAAGAAAGGAGACGCAAAAGAGGTCAATGTTTAT
GATTTTCCATCACTGGGGATCGGGGTGGCAATTCCATACGGTGCTTATGATATTAATAGGGGTGAAGGATTCGTGAATGTCGGCATTAGCCGTGACATTT
CTGAATTTGCAGTTGAAAGTATCAGGCAATGGTGGAAAGTATCAGGAAAAAAGCACTATCCCGATGCCAGGGAGTTGTTGATCTGTGCAGATGGTGGCGG
AAGTAATGGAAGTCGTAGGAGAGGATGGAAATTCTTTTTACAAGAATTGACTGATCAAATAGGGATACCGATATCTGTCTGTCACTTTCCTCCTGGGACA
AGCAAATGGAATAAGATAGAGCATTGTATGTTCTCGTTCATCAGCATGAATTGGAAAGGTGAGCCACTTGTTACTTATGAAACAATTATCAAACTTATTA
GCGCAACTACAACAAAGAAAGGGCTCAAAGTGGTTGTCCGTCTTGATAAGAGGGGATATGAAGGTGGGGTAAAGTTCTCTGACGAAGATATGGCAAAACT
AAACATAAAAGCTCACACGCTGCATCCTAAATGGAATTATTCTATTGTACCAAGAAAGGATACGGAACCGGATGGTGACTGAAAAATCGATAGGTTATTT
TCTGGCAAGCCC
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
1224 bp407 aa591282+No
ORF function : Transposase
Chemistry : Unknow

ORF sequence :

MDDIEKHKNWLKVLALADEALKRKLAAAKALDLGWGGISTVTRITGMSPTTIRKGIHELDNLEKLEQPKRIRKTGGGRKRADIKNPKIVEDLEAIMDENT
AGDPMSFLKWTCKSTYKIADELNLRGHKISAETVRLLLRERDYSLQANVKTKEGGSEPERDAQFRYINEQVKKIVAQGDPVISVDTKKREIVGDFKNPGR
TWRKKGDAKEVNVYDFPSLGIGVAIPYGAYDINRGEGFVNVGISRDISEFAVESIRQWWKVSGKKHYPDARELLICADGGGSNGSRRRGWKFFLQELTDQ
IGIPISVCHFPPGTSKWNKIEHCMFSFISMNWKGEPLVTYETIIKLISATTTKKGLKVVVRLDKRGYEGGVKFSDEDMAKLNIKAHTLHPKWNYSIVPRK
DTEPDGD

 

Blast result :
Comments
ISArch16 is 41% aa similar to orfB of ISPst3.
References
1] Hallam,S.J., Putnam,N., Preston,C.M., Detter,J.C., Rokhsar,D., Richardson,P.M. and DeLong,E.F. (2004)Science 305 (5689), 1457-1462.

2] Hallam,S.J., Preston,C.M. and DeLong,E.F. (2004) Direct Submission GenBank.

3] Putnam,N., Detter,J.C., Richardson,P.M. and Rokhsar,D. (2004) Direct Submission GenBank.

4] ISfinder annotation (2008).