ISYps3

  • Family Tn3
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s) TnYps3
Accession numberTranspositionOriginHost
ND Yersinia pseudotuberculosis
Yersinia pseudotuberculosis plasmid pGDT4
DNA section
IS Length : 5723 bp

Ends


IR Length : 43/48

IRL : GGCCCAGTGGGAGCGAAGCTACAAAATGCGACATCTGACTTTTTTGAGCT
IRR : GGCCCAGTGGGAGCGAAGCTACAAAATGCGACATTTGTCTTCGTTGGGGC

Insertion site


Left flankDirect repeatRight flankDR Length
TTTTTATTCTCAGTTGGGGCAAGTT5
GCATCCTAATAACCACTGGC0

DNA sequence

GGCCCAGTGGGAGCGAAGCTACAAAATGCGACATCTGACTTTTTTGAGCTGGATCTGAGTAAAAATCACTTACCTGTGAAATGGTTGCTGTAGCGATTAC
CCACTGATGATTCAGGGAGTTAGAATTTTGTCACAGGATCAGCCATTTGATGAAAGGGATGTTTGGAGTTTGCTTGCTGACGAGCTTTCCTTACTCCCTG
GCATGACCGATGCCGGTCGCTTAGGGTTTGCCATTCAATTGAAATTCCGACAAACATATGGCCATTACCCTGAATCAATAAGCGAACTCCCCTCAGGTAT
TGTGCGCGTTATTGCTGAACAGATTGGATGTACTTCTGTACCCTTCGAGAATTACCCTCTTCAGGGACGACAGGCCCAGCGTCACCGACAAAATATTCGT
CGCTATTTGGGTGTCAGACTCCCCAATAAAAACGATATAGCGCAGCTTACTGCCTGGTTAACCGAATTTATCCTTCCATTAAACCCGCAAGCTCTACATG
GCAGTGAGCTTGTTTCTGACTGGTGTCAGGAGCAGAAGATTGAACGTCCCGCAGCCGATCACCTGGATCGGGTTATTCGTTCAGCTGTGCACCAGTTCGA
AACAGAACAGCAAAACATCATATTTACCCGACTTTCACTCGACAGTAAGGTTGCCATCAACCATTTACTGTCAGCCGAAGAACCCGGTACCGACAGAGTA
ACTGAAGTCACGTTGAGTAGACTCAAAGCCGACCCGGGAAGAGCCAGTCTGGAGAATGTCCTTTCCGTCATCGCACAGCTAAAATGCCTTGATAGCGTTG
CGCTACAGCCGGGTATTTTTCAGGGAATATCTCCTAAATTCATCGTGCAGTTTCAACAACGGTGTGCCAGTGAATCGATCAGGGAGCTTCGTCGCCACCC
TTCGGCGATCCGTTATAGTATGGTGGCCATGTTTTGCTGGCGTCGCCGCCAACAGTTGACCGATGCATTGATTGAAATGTTGATGATACTGATCCATAAC
CTCGGTACCCGGGCTGAAAAAAAAGTCGATAAAAAGCAGTTCGCAGCGTTTAAAAAAGTTAGGGGTAAGGCGCGTCTGCTGTTTCGCATGGCCGAAGCCA
CTGTTGACCAGCCGGACGGTGTCATAAAAGAGGTTGTCTATCCTGTCGTTTCTCAGAAAATGCTGCAAAATCTGGTCGATGAATTCAAAACACTGGGGGT
AAATACCGAACAGGAAGTCCATGAATCCATGCGTTCTTCTTACGGTAGCCACTATCGACGCATGTTGATGCCGGTGCTGGACAGGCTTGAATTTCAGTCT
GGTAATGCGCTGTATCGACCCGTTATTGATGCCATTCAGATCATTAAAGAAAACAGAGCCAGCAATCAGTATTTCTACGCTGTGGGCGATGTACCCGTTG
ACGGTATTATTCAGAAAAAATGGCGGGATATTGTCATCGAACAGAGCAAATCAGGCGAAGAACGAATCAATCGCATCAACTATGAAATTTGCGTTTTACG
GGCTTTACGTAAGAGTCTGCGTAACAGAGAAATTTGGGTAACAGGCGCGGACCGTTATCGTGATCCAGCAGAGGATCTTCCCGAGGACTTTGCCACTAAC
CGGGCCTATTATTATTCCTTGTTGCAGGCTCCTGCCGATGCGACAACCTTTATTACTCAAATCAAAGACAGGATGCGCCATTGGCTCGGTACCCTAAATA
ATGGCCTGCCAGATAACCCCAAACTTCGCATCAGGGTGCAGGGAAAAAATCGTATTCACCTGACGCCACTGGACAAACAGAGTGAGCCCCCCAACACTGC
TGCGCTGAAGCAGGAGATTGGCCATCGGTGGGCCGATCTGGAGTTAATAGACATACTCAAGGAAGTCGATTTACGGGAACATTTCTCGTCGTTATTTCGC
ACATCAGCCAGCCGGGAAGTTCTTGAACCTGAGGTATTGCAACGTCGTCTGTTGTTATGTCTGTTTGGCCTCGGTACCAATGTAGGACTGAAACGCATTG
CCAGCCAGCAACCTCGCGTCAACTATGATGAATTGCGCTACGTTAAACAGCGGTTTATTCAAAAAGATGCTTTGCGCTCAGCGATTTCACATATTGTGAA
CGGTATTTTCCGTATTCGTCAGCCGGCCATATGGGGGAATGCGACGACATCCTGTGCCGCAGACTCCCGGAAATTTGGTGCCTACGATCAAAATCTGATG
ACCGAATGGCATGCGCGCTATGGCGGGCGTGGCGTGATGATTTACTGGCATGTGGACACGCACTCCACATGTATTTATTCACAATTGCGTCGATGTTCTT
CATCGGAGGTGGCTGCCATGATGGAGGGCGTTCTGCGCCACTGTACTGACATGGAGATCAACCACCAGTATGTGGACAGCCACGGGCAAAGTGAGGTGGC
TTTTGCGTTCAGCGATGTTTTGGGGTTCGATCTACTGCCGCGCCTGAAAGCCATCGCCCGACAGAAACTGTATGTGTGTGAAAAGGAGGATGCATCGTTG
TACCCGCACCTGACCCCAATTTTAACCCGGGGGATCGACTGGGAACTGATCGCACAGCAGTATGACGAAATAATCAAATATACAGCGGCACTTAAAGTCG
GAACAGCCGAACCCGAGGCAATATTGAGGCGATTCACCCGCAATAACATCCAGCATCCAACCTATAAGGCATTGGCTGAGTTGGGCAAAGCGATTAAGAC
TATCTTCCTCTGCCGTTATTTGCATGATGAGTCACTGCGTTGCGAAATTAATGCGGGTCTCAACGTCGTGGAAAACTGGAACAGCGCCAATAATTTTATT
TTTTATGGCGAACACGGAGAATTTACCAGCAACCGGACTGCGGATCAGGAGCTATCTATGCTCTCATTGCACCTGTTGCAAATCAGTTTGGTCTACATCA
ATACACTATTGATCCAGAATGTGCTGTCGGAGCCGACCTGGCGTCAGCGAATGACCGAAGAAGACTGGCGTGGTCTGACGCCATTGATATACCACCATGT
TAATCCGTATGGCCGTATCGAGTTGAACATGGAGCAGCGGCTGGCATTGGCCGCCTGATGGTGTCCAAAACCGTTCGGTTTCGTACACCCACTTACAAAT
ATGTACGAAAGTTAGTAAAATTCGTTTCGGACATGCATTATAATTCGTACATCCATTCCGTACAGAAATTTTCACTATGTCACGAGTTTTTGCCTACTGT
CGGGTCTCCACTCTGGAACAGACTACTGAAAACCAGCGCCGGGAAATTGAGGCTGCCGGTTTTGCCGTGAATCCTCAGCGATTGGTTGAGGAACACATTA
GTGGATCGGTGGCGGCCAGTGAGCGAGCTGGATTTATCCGACTGCTTGATCGTATGGAAAATGGTGATGTGCTGATTGTCACCAAACTGGACCGTCTGGG
ACGTAATGCGATGGATATCAGAAAAACGGTGGAGCAACTGGCGGCATTAGACATTCGTGTTCACTGCTTGGCTCTTGGGGGCGTCGATCTTACTAGCCCA
GCGGGAAAAATGACCATGCAGGTGATTTCAGCTGTGGCCGAGTTCGAACGTGACTTGCTTCTTGAACGCACACATTCGGGTATTGTCCGGGCAAAGGCAG
CAGGAAAACGCTTCGGGCGTCCGCCCGCATTGAATGAAGAACAGCATCAGGCGGTGCTCATTCGTCTGAAAGCAGGGGACAGCATCAGTGCTGTTGCTCG
TCAGTTTAGTACGACACGGCAAACCATTCTCAGAATAAAGGCGGCAAGTTCATCTTGTTAATCCGGAATAATTTTATGCCTGAAGAGGCAAATAACACGC
CCTGGCGTTTCATACAGCCTGCCCTGGGAGGGATTTCATGGCATCGTTAACAAAAAAACAAACCGCACAGCTTTCAGAGTTGAGTCATGACGTGTTGTTA
AATATCATTCATGACCTGATACAGGATAACAAACAGGCCAGAACCATGCTGGTGAATGGGTATCTATTATCGGCACCGGAGATAATCAAATCCGTCGAGA
AGGAGTACGCCCGACATACCAAAAGCAAACGTTTTTATGATTACTACGACGCAGATACCTTTTTTGACGAACTGACACGCAGTATGGCGAACCCCCTTGT
GGGAGTCGCCCACTTGCTCCCTGAGCAAGCGGAAAATCTGAGCGTAAAAATGATGCTTGAGTTCGAAAAGTTCACCGCGAACGTAGATACTTCCAGCGGG
AGTTGGATGGACTACTACACCGTTCTACTGGATGCGTGGATGAAATCACTGGAAGCACAAAAAAACAGCGGCCCTGTCTTCATTGCCCAAAAGATATTCA
CCGTTGTTGAAAGGGAATTCTATTTTGGAATAGAAATATTTAAAAGATACCGCACCTTACTCGGTATGGATATTTTACGGGCAATCCGGGATATGTATTA
TCAAAAAAAACGCCCCGGAGAAGCCTTGGGCCTGAGTGTGATAATACAAGACCTCGATTTTATGACGATGGCGTTTAAAAACGATGAGTTTGGCCATGCC
ACACACTATTTTGATTATGCCAGATTACTCATGGAAGACCTACGGGCCGATGAAGCGCTTGCCGTATTAAAAAATCAGCAGAATGACGACGGGGAGATCA
CAGATAATATCATATGGAATGAATTATTTATTCAAGCCCTGATTGAAGAAGGGAGAAAAGAGGAAGCCAAAGCCCACTGTATTACAGCATTCACTTTTCA
GTGTGATACAAGGTTTTATCACCTGTACATAAAAGCCGGTGAGAAAGGCGTTGATCACAGCCCCGTATTCCTGAACATAGCAAAGGATATGGGGTTAGCG
CCGTATGTTTGTTTTGCGTCAGACATCGAACGATATGATTTAATCGACACCTGCATTATCGCCACGCCAAAAGCCAACTTCGCCGACTCGCTGGCTTATA
TCACCCATTCATTTTTACGGACATTATCCAGCACCCTGTATAAACACGGCTATGCGCTTACGGCTACTCTGTTGCGGCGTTTTTTGGTGGAGGACAACAT
TCAGCAATCAAAAAGCAAATATTACAGCTATGCCGCCTCGGACATGAAAAAAGCCATCGATTATGGGGAAGGACTGGAAGAGAGCGTACAACTCCCAGGG
ACACTGACCTACCTCAATGCGCTCCACGAACAGCACAAACGTAAAACCGCACTCTGGCCGTTGATGGCGGATAAAATCAAGGGATTATCGGTAGGAAAAG
ATGGGATCCATTACAACGGAGGTGCCTCATGACATCACAGGAACTGTATGACTACGCGGTGTCACTGCTGGCAAAGCGGGATTACGCATCCGGTGAATTG
ACGCGGGTTCTGGGTAATCTGACGGAAGACAGAGAGGATATCGACAGGGCGTTGTCGCATCTGGTTGAGTGCGGTTATCTGGATGATCACCGTCTGATTG
AAAAACATGTTCGAAAGAAACATGGCCCGACCAGAATCAAACAGGAAATCAGGCAAAAGGGTTTTCCTCAGGAGTTGGTCGAGCAGGCGTTGGAGAAAGT
TGATGTGGACTGGTATGCCATGGCAAGGGAGCTGAAAGTCAGTAAATTTGGTGATGAGATGCCGTCAGAAGCCAAAGAGAAAAACAAACAGATTCGCTAC
CTCCAGTACAAGGGGTTTTCGATGGACATGATATTTGAGGCATTGAGCTGATCATGGTTTGTTGTTAATCAGAGCCCCAACGAAGACAAATGTCGCATTT
TGTAGCTTCGCTCCCACTGGGCC
Protein section
ORF number : 2

 

ORF 1
LengthBeginEndStrandFusion ORF
2952 bp983 aa1073058+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MIQGVRILSQDQPFDERDVWSLLADELSLLPGMTDAGRLGFAIQLKFRQTYGHYPESISELPSGIVRVIAEQIGCTSVPFENYPLQGRQAQRHRQNIRRY
LGVRLPNKNDIAQLTAWLTEFILPLNPQALHGSELVSDWCQEQKIERPAADHLDRVIRSAVHQFETEQQNIIFTRLSLDSKVAINHLLSAEEPGTDRVTE
VTLSRLKADPGRASLENVLSVIAQLKCLDSVALQPGIFQGISPKFIVQFQQRCASESIRELRRHPSAIRYSMVAMFCWRRRQQLTDALIEMLMILIHNLG
TRAEKKVDKKQFAAFKKVRGKARLLFRMAEATVDQPDGVIKEVVYPVVSQKMLQNLVDEFKTLGVNTEQEVHESMRSSYGSHYRRMLMPVLDRLEFQSGN
ALYRPVIDAIQIIKENRASNQYFYAVGDVPVDGIIQKKWRDIVIEQSKSGEERINRINYEICVLRALRKSLRNREIWVTGADRYRDPAEDLPEDFATNRA
YYYSLLQAPADATTFITQIKDRMRHWLGTLNNGLPDNPKLRIRVQGKNRIHLTPLDKQSEPPNTAALKQEIGHRWADLELIDILKEVDLREHFSSLFRTS
ASREVLEPEVLQRRLLLCLFGLGTNVGLKRIASQQPRVNYDELRYVKQRFIQKDALRSAISHIVNGIFRIRQPAIWGNATTSCAADSRKFGAYDQNLMTE
WHARYGGRGVMIYWHVDTHSTCIYSQLRRCSSSEVAAMMEGVLRHCTDMEINHQYVDSHGQSEVAFAFSDVLGFDLLPRLKAIARQKLYVCEKEDASLYP
HLTPILTRGIDWELIAQQYDEIIKYTAALKVGTAEPEAILRRFTRNNIQHPTYKALAELGKAIKTIFLCRYLHDESLRCEINAGLNVVENWNSANNFIFY
GEHGEFTSNRTADQELSMLSLHLLQISLVYINTLLIQNVLSEPTWRQRMTEEDWRGLTPLIYHHVNPYGRIELNMEQRLALAA

 

Blast result :
ORF 2
LengthBeginEndStrandFusion ORF
585 bp194 aa31773761+No
ORF function : Accessory Gene
AG : Tn3 resolvase

ORF sequence :

MSRVFAYCRVSTLEQTTENQRREIEAAGFAVNPQRLVEEHISGSVAASERAGFIRLLDRMENGDVLIVTKLDRLGRNAMDIRKTVEQLAALDIRVHCLAL
GGVDLTSPAGKMTMQVISAVAEFERDLLLERTHSGIVRAKAAGKRFGRPPALNEEQHQAVLIRLKAGDSISAVARQFSTTRQTILRIKAASSSC

 

Blast result :
Comments
ISYps3 was reconstructed in silico by deletion of ISYsp2 (IS110).
There are 2 copies of ISYps3 on the plasmid pGDT4, one copie on each strand.
ISYps3 orfA is 45% aa similar to ISSod9(orfD) and orfB is 90% aa similar to ISSba14 (orfA).
References
1] Didier Mazel (2008) Direct Submission