ISRhsp5

  • Family IS66
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
NC_007490 ND Rhodobacter sphaeroides
Rhodobacter sphaeroides 2.4.1
DNA section
IS Length : 2528 bp

Ends


IR Length : 15/21

IRL : GTAAGCGACCGCCCATCGCCCTCGTTGCCTGATCGGCAGCGCTTTCCGAG
IRR : GTAAGCGCAGGCTGACCGCCCCTCGGGTAGCGGCTTGACTATCCGCGGAA

Insertion site


Left flankDirect repeatRight flankDR Length
ATCCATGCATGGTGGTCAGCTACAACGG8

DNA sequence

GTAAGCGACCGCCCATCGCCCTCGTTGCCTGATCGGCAGCGCTTTCCGAGATGACGCCTGTAACAACGGAGGCGTCGATGGATACGGACGTACAAACATA
CGTAACTTCTCACAGTCACGAGCAAGGATATGCCGGTCGTATCGAGGTTGTGACGGGTCCGACCGGTAGGCGGCGGTGGCCGGAGCATGTGAAGGCCGCG
ATGGTGCTGGAGACCTTCCGCGACGGGGTGTCGGTTTCGGATGTCGCGCGCAAGCACGGAGTCTCGGCGCCGCAGCTGCATGCCTGGCGGCGGGCGGCCC
GTGAGGGCCTTCTGCCGATGCCGGAGGATGAGGCGCTAGGGCTCGTGCCGATCGTCGTGGCGGATGGGGGACAAAGCGCTGGTGGTAGATCTGATGCCTG
CCTCGCTCTGGAGATTGGTGACGTCAGGATCCTCGTGCCTGCCGTCTTTGACGCCGCCCACCTCGGCCGGGTGATCGCAGCGGTCCGGAGCGCGGCGTGA
TCCTGCCGGGCGGGATCACCCGGGTCTATCTGGCGACGCGGCCAGTCGATTTCCGAAAGGGCCATGCCGGGCTGGCGCTGATCGTGCAGAGCGTGCTGGG
CCACGATCCGTACAACGGCGCGATCTACCTGTTCCGCTCGAAACGCGGTGACCAGCTGAAGTGCCTGGTGTGGGACCAGACCGGCCTCGTTCTGGTCTAC
AAGAAGCTCGAGGGCGGCGCCTTCCACTGGCCGAAGCCGGCCGATGGGGTGATCCGGCTGTCGCCGGCGCAGTTCTCGGCCCTCATCGAAGGGCTGGACT
GGCGAGCGGTCCGGGCCGAGCGGCGGCCGCGGCCGCGACTGGCCGGATAGCCGCGGCAGGGTGACTCGGGCTGGCGTTTCGGCAGGCATTGCAGCGGGTT
GTGGGGTATCCTCGCCCCATGGCATCGATCCGAACCAGTGCGGCCCGCGTGGCGGATCTCGAGCGGCGGCTGGCCGAGGCGGAAGCCGCGCGCACCGCGG
CCGAGGCCCGCCTGGTTGAGGTCGAGGAGGCCCGCGCCCGGCTGGAGCGGCTGCTCGCACAGATGCGGCGCGACACCTTCGGCTCGAAGTCCGAGAAGCT
CGACCCCGACCAACGGAACCTGCCGTTCGAGGATGTCGAGGCGGCGGCCGGCATGCTGGCCGCGGCGAGCGAAGCGGCCGAGAAGGCGCTCGGCACCCGG
AAGGCTCCGTCCCGGCCTTCGGAGCGCAACAAGGGGCACCTGCCGGAGCACCTGCCGCGGATCGAGCGGGTGATCGAGCCCGACAGCATCCTTTGTCCTT
GCGGCTGCGGCGAGATGCAAAGGGTGGGCGAAACCAGGACCGAGCGTCTCGATGTCATCCCGGCGCAGTTCCGCGTGCTGGTGACGATCCGGCCGAAATA
CGTCTGCCGGACCTGCGCGGGGGCACAACATGCCCAGGCTCCGGCGCCGGAATGGCTGGTGTCGCGCGGCCTGCCGACTGAGGCCTTGGTCGCGCACAGC
GTGGTGGGCAAGTTCGGCGACTACCTTCCGTTCTACCGCCAGGCCGACATCTACCGGCGCCAGGGGATCGAACTCGACCGCACGATGCTGGCCGAGTGGT
CGGGGCGGGCGGCGCAGCTGCTGGCCCCGGTGATCGACGCGATGATGGCCGAGCTTCGACGAAGCGACCGGCTGCAGATGGACGAGACCACCGCCCCCGT
GCTGGCGCCCGGGACCGGCGCAGTGCGCAAGGACTGGCTATGGGTGGTGTTGCGCGACCAGCGGGGCTGGGGCGGCGGCGATCCTCCGATCGTGGTCTTC
CATCACTCGCAAAGCCGCGGCGGCAAGGTCGCGCAGGAGATCCTGAAGGGGTTCGCCGGCGGTACGCTGCTGGTTGACGGCCATGGCGGCTACGACCTGC
TGGCCGACCCCAAGAAGACCGCGAAGCCCTGGACCCTGGCCTTCTGCTGGACACATTGGAGGCGGCGCTTCGTGAAGTTCAGCCAGGACACGCCTTCGCC
GATCTGCGACGAGATGATCGCGCGGATCGCGCAGCTCTACGCCATCGAGAAGGAGATCCGCGGCCGTGATCCCGCCGCCCGCGTCGCGGTCCGCCAGAAG
TTCTCGAGGCCCATCGTCGAGGCGCTCCGGCCCTGGCTCGAGGGCTGCCTTCAGGATCTCTCCTCGTCCAACGAGCTCAGCACGCACATCCGGTACGGGC
TGAAGAGATGGGACGGCATGACCCGTTTCCTCGAAGACGGCCGGCTCGAGATGGACACCAACGGGGTGGAGAACGCGATCCGTCCGATTCCACTTACAAG
AAAGAATGCACTATTTGCCGGCTCCACGGATGGGGCGAAGACATGGGCCCGCATCGCCTCGCTGATCGGCACCTGCCGTCTGAACGGCGTGAACCCTGAG
GCGTATATCGCAGCGACCCTCCGCAAGATCCTCGACCAGCACATGCAGAGCGACATCGCGGAACTGATGCCCTGGAACTTCCGCGGATAGTCAAGCCGCT
ACCCGAGGGGCGGTCAGCCTGCGCTTAC
Protein section
ORF number : 3

 

ORF 1
LengthBeginEndStrandFusion ORF
423 bp140 aa78500+No
ORF function : Accessory Gene
AG : IS66 TnpA

ORF sequence :

MDTDVQTYVTSHSHEQGYAGRIEVVTGPTGRRRWPEHVKAAMVLETFRDGVSVSDVARKHGVSAPQLHAWRRAAREGLLPMPEDEALGLVPIVVADGGQS
AGGRSDACLALEIGDVRILVPAVFDAAHLGRVIAAVRSAA

 

Blast result :
ORF 2
LengthBeginEndStrandFusion ORF
354 bp117 aa497850+No
ORF function : Accessory Gene
AG : IS66 TnpB

ORF sequence :

VILPGGITRVYLATRPVDFRKGHAGLALIVQSVLGHDPYNGAIYLFRSKRGDQLKCLVWDQTGLVLVYKKLEGGAFHWPKPADGVIRLSPAQFSALIEGL
DWRAVRAERRPRPRLAG

 

Blast result :
ORF 3
LengthBeginEndStrandFusion ORF
1572 bp523 aa9192490+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MASIRTSAARVADLERRLAEAEAARTAAEARLVEVEEARARLERLLAQMRRDTFGSKSEKLDPDQRNLPFEDVEAAAGMLAAASEAAEKALGTRKAPSRP
SERNKGHLPEHLPRIERVIEPDSILCPCGCGEMQRVGETRTERLDVIPAQFRVLVTIRPKYVCRTCAGAQHAQAPAPEWLVSRGLPTEALVAHSVVGKFG
DYLPFYRQADIYRRQGIELDRTMLAEWSGRAAQLLAPVIDAMMAELRRSDRLQMDETTAPVLAPGTGAVRKDWLWVVLRDQRGWGGGDPPIVVFHHSQSR
GGKVAQEILKGFAGGTLLVDGHGGYDLLADPKKTAKPWTLAFCWTHWRRRFVKFSQDTPSPICDEMIARIAQLYAIEKEIRGRDPAARVAVRQKFSRPIV
EALRPWLEGCLQDLSSSNELSTHIRYGLKRWDGMTRFLEDGRLEMDTNGVENAIRPIPLTRKNALFAGSTDGAKTWARIASLIGTCRLNGVNPEAYIAAT
LRKILDQHMQSDIAELMPWNFRG

 

Blast result :
Comments
orfA of ISRhsp5 is 53% aa similar to orfA of ISRosp4. orfB and orfC are respectively 70% and 63% aa similar to orfB and orfC of ISApr6.
References
1] Copeland,A., Lucas,S., Lapidus,A., Barry,K., Detter,J.C., Glavina,T., Hammon,N., Israni,S., Pitluck,S., Richardson,P., Mackenzie,C., Choudhary,M., Larimer,F., Hauser,L.J., Land,M., Donohue,T.J. and Kaplan,S. (2005) Direct submission GenBank.
2]ISfinder annotation (2008)