ISDka2

  • Family IS200/IS605
  • Group IS605
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
ND Desulfurococcus kamchatkensis
Desulfurococcus kamchatkensis
DNA section
IS Length : 1889 bp

Ends


Left end : GGGATGAGGATTTATAAGCTCGTACTCTTTAAAGTATTCTAGGGGCTAGGCGCGGTGGGTAACTCTCAGACATGGTTGAGACTTAGGAGTACTAGGCATG II struct. : No
Right end : TGAGGAGATACTCCTGTAGCGCCTTGTAAACCCGAACAGGCAGAGGAACCGATGAACCACCCAAGAACCCTTGTCCTTTGGAAGGTCGGAACGGTGTGAG II struct. : No

Insertion site


Left flankLE cleavage siteRight flankRE cleavage site
AAAACCTCGCCCTTAGGGTGGGGTGAAGTAATCAATTAAG

DNA sequence

GGGATGAGGATTTATAAGCTCGTACTCTTTAAAGTATTCTAGGGGCTAGGCGCGGTGGGTAACTCTCAGACATGGTTGAGACTTAGGAGTACTAGGCATG
TTAAGTACTGGTGTGCCTACCACTTCGTGTGGATACCTAAGTATAGGAGGGACATTCTCATTGGCGACGTCGCTGAATACACTAAAGAAGTCTTGAGAGG
GATCATTACGGGTATTGGTTGCGAGCCTCTTGCCATCGAGGTCATGCCCGATCACGTCCACGTCCTCCTCCTATGCCCTCCGCGCCTAGCCCCCTCCTAC
GTAGCGAACTACTTGAAGGGTAAGAGTGCTAGGCTGATACTGAAGAGGTTTCCGCAACTGAGAGCCAGAGTTAAGTACGGGAAGCTGTGGTCTAGAAGTT
ACTTTGTCGCCACCGTGGGTAACGTGACGGCTGATATTGTGAAGAGGTATGTTGAGGAGCAATGGTCTAAGGTGAGAGAGTGAAACGGTGTAGCGTGGTT
GAGCTGGATCCAGACAGGGAGGCGTGGAATAAGCTTAAACTACTATGTAGCATATCCTCCAAGCTTTGGAACGAGGTCAACTACGCTAGGAGGAGGCAGT
TCTTCGAAACTAAAAGAGTGGATCTTAGAAGCACCTACAAGGAGTTCTACGAGAGGTACAAAACGCTAATAGGTTCCGCTACAGCACAGCAAGTCCTGAA
TAAAAACGATGAAGCCTGGAGATCCTTCTTCGGTTTGCTAAAGGCTAGGAAGGAGGGCAGACTACCACCATTCATGAGAAGGGTGAGCCCGCCGGGTTAC
AAGAAGAGGGGTGGGTTCAGGACACTATGGACTGTCCTGAGGAAGGATCAGTATAGGATTGAGGGCGATAGGATCGTCATCAAGGGTCTCGGAGCCATAG
GGGTCATCGTTGTCCAGTATAAAGGTTTAATCCACGTGAGGGGGGAGCAGGGTAGGCTGGAGATAAGATATGACCCCGATAGGGGTAGGTGGTATGCGCA
CATATCCTTCTCGGAGGTTAGGGAGAAGCTTGTCAGAGGATCTTGGGTTGAGGTGCCGAGAAAGCCTAGAGGCAGCCTAGAGGCTGGAGTGGACATCGGC
ATAAACAATCTTATGGCAGTCTACGTCGAGGACGGCAGGGCGTTTCTAGTCAATGGGAGACCTCTGAAAGCGATATCGCACTACTGGATGAGGAGGATAG
CGCGGTACCAGTCAACGTTGAACAAGTATGGGTTGACGACGTCTAGGAGGCTCAGGCTCATGTACAGGAGTTGGAGGTTGCAGATTAAAAACTACATAGA
CTCTAGGGTCAGATCTGTCATGGAGAAGCTCTACGAGATGGGGGTCTCAAGGCTGAGGGTAGGGTATCCAAGATACATCGCCCAAGAGAGCGGGGACTTC
AACAACGTCCACGTCTGGACCTACAGGTACCTGCTGAGGAGGCTAGTGGAGGTGGGCGAGGAGTATGCGATAGAAGTCGTACTATCGGACGAGAAGTACT
CCTCCTCAAAATGCCCGCTACACAGAAGTGTGGAGTGTGGAGTGAGGATAAAGAGGGGACTGTTCAAATGCGTCAAAACCAATAAGGTGTTCAACGCAGA
CCTAGTAGGAGCATACAACATACTAGTAGACGCAGAACCCATAACCCCGAGCCCCGGGAGGGGTAGGGGTAATGGGCCGGAGACCCGGCCCAGGGCTAAA
CCCTACCAGAGGGGATGTAGCCCAAACCTCCCAGCCCTAACGAGCGGAACCCCCGCCCTAAAGGGCGGGGAGGAGGTCAGAGGGCGCTTTGAGGAGATAC
TCCTGTAGCGCCTTGTAAACCCGAACAGGCAGAGGAACCGATGAACCACCCAAGAACCCTTGTCCTTTGGAAGGTCGGAACGGTGTGAG
Protein section
ORF number : 2

 

ORF 1
LengthBeginEndStrandFusion ORF
429 bp142 aa55483+No
ORF function : Transposase
Chemistry : Y1

ORF sequence :

MGNSQTWLRLRSTRHVKYWCAYHFVWIPKYRRDILIGDVAEYTKEVLRGIITGIGCEPLAIEVMPDHVHVLLLCPPRLAPSYVANYLKGKSARLILKRFP
QLRARVKYGKLWSRSYFVATVGNVTADIVKRYVEEQWSKVRE

 

Blast result :
ORF 2
LengthBeginEndStrandFusion ORF
1329 bp442 aa4801808+No
ORF function : Accessory Gene
AG : TnpB

ORF sequence :

MKRCSVVELDPDREAWNKLKLLCSISSKLWNEVNYARRRQFFETKRVDLRSTYKEFYERYKTLIGSATAQQVLNKNDEAWRSFFGLLKARKEGRLPPFMR
RVSPPGYKKRGGFRTLWTVLRKDQYRIEGDRIVIKGLGAIGVIVVQYKGLIHVRGEQGRLEIRYDPDRGRWYAHISFSEVREKLVRGSWVEVPRKPRGSL
EAGVDIGINNLMAVYVEDGRAFLVNGRPLKAISHYWMRRIARYQSTLNKYGLTTSRRLRLMYRSWRLQIKNYIDSRVRSVMEKLYEMGVSRLRVGYPRYI
AQESGDFNNVHVWTYRYLLRRLVEVGEEYAIEVVLSDEKYSSSKCPLHRSVECGVRIKRGLFKCVKTNKVFNADLVGAYNILVDAEPITPSPGRGRGNGP
ETRPRAKPYQRGCSPNLPALTSGTPALKGGEEVRGRFEEILL

 

Blast result :
Comments
The genome of crenarchaeon Desulfurococcus kamchatkensis contains one full size copy of this transposon and its one defective copy.
ISDka2 is 80% (ORFA) and 58% (ORFB) aa similar to ISSis2.
References
1] Ravin N.V., Mardanov A.V., Beletsky A.V., Kublanov I.V., Kolganova T.V., Lebedinsky A.V., Chernyh N.A., Bonch-Osmolovskaya E.A.,Skryabin K.G. (2008) Complete genome sequence of the anaerobic, peptide fermenting hyperthermophilic crenarchaeon Desulfurococcus kamchatkensis (submitted)