ISPlr1

  • Family ISAs1
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s) mcyDIS2, mcyDIS1, mcyEGIS, mcyAIS
Accession numberTranspositionOriginHost
AM039947 ND Planktothrix rubescens
Planktothrix rubescens No110
Planktothrix rubescens No178
Planktothrix rubescens No139
Planktothrix rubescens No145
Planktothrix rubescens No161
Planktothrix rubescens No166
Planktothrix rubescens No169
Planktothrix rubescens No170
DNA section
IS Length : 1423 bp

Ends


IR Length : 13

IRL : CAGGGCTGTTTCAAAGTCAGGTGAAAAAGAGTAAAGAAAGAGCGATCGCC
IRR : CAGGGCTGTTTCATGTTTGAAAATTATAGCCTACTTTTGGGTCATAATTC

Insertion site


Left flankDirect repeatRight flankDR Length
TTCTGCCCCCCCCGTGCACGGGGGGTTTGG10
CTGCCCCCCCCGTGCACGGGGGGTTTGGGG10
GTTTGGGGGGGGCTGTTCCCTCTCTCAACT10
TCAACTACCACCCAAAACCCTAGCCTTCCG10

DNA sequence

CAGGGCTGTTTCAAAGTCAGGTGAAAAAGAGTAAAGAAAGAGCGATCGCCACCTGATAAAATGGAGAGCGATCACCATTTTTTTCTAAAATAAAGATGCT
AACAAGTTTAATAGAAAATTTAAAAGAAGTCAAGGATTTCCGAAAAAATCAGGGAAAAAGGTATAGTTTATGGGAAGTGCTATTAGTAGTAGTTTTAGGG
GTGATGTCAGGGCATCAAGGATATCGAGAGATGGAATATTTTGTCAAAGCCAACGAAGTTATCCTGAAAAGAACATTCAATATCTATAGCCAAGGAATGC
CATCTTATTCAACAATAAGGAGGGTGATGAGAGGAGTAGACGAGAAGGATTTAAGCAAAATAGTAAAAGAATGGTCAAGAGAGAATTCTCCTAAATTAAA
GGGAATAGAGGGATTAGCAATAGATGGAAAAAGTTTAAGAAGTACGGTAAAAGACCCAGGCAATCAGCAGCAAAACATGGTAATAATGGTATCTCTATTT
AGTCAAGAAACCGGATTAGTATTAGCGACGGAAAAGTTCGAGAGTAAAACCGGTTCAGAACAAGCTGTAGCCCAAGGGATAATAGAAGAATGTGGTCTAA
AAGGAAAGTTAATAACTGCGGATGCGTTACATTGTAATGTCACCCCAGTCCGAAAGATTATCGAGAGTGAAAACGATTATTTAATCGCGGTTAAAAAGAA
TCAAATCAAACTGTATAATCAAATTGAAAAAATTACAAAAACGACGAAAGCTGAAAGTATAGATACTCAAAAAGAGAGGGGTCATGGACGAGAAATAACT
CGTCGGGTATCAGTGTTTAAAAATTCGATAAAAATTGAAAGCCCTTGGGAACATATTCAAAGTATAATTCAGGTAGAAAGGTGGGGATACAGAGGAAAAA
AGCCTTATAGAGAAACGGTTTATTATATAAGTAGTATCTGGGAAAAGGCGGATTTTTTTTCCAAAAAAATTAAAGGGCATTGGGGGATTGAGAATCAAGT
TCATTGGGTAAAAGATGTGTTATTTAAAGAGGATAGTATGAAAATTCATCAAGTACAAGCCGCGACTAATTGGGCACTGCTCAACACCCTAGGATTGAAT
ATTTTCAGAGGTTTAGGATTTTTGTCAATAACAGAGGGAAGAAGGTGGTTAGGAAATCATTGGGAGAAATTAGTGGCTATCTCTTAATCCGAAAGTTAAA
AATGAAAAAATAGAGCAATTAATTTAGGAAAAATAGATAAAAATCGGGAATGTAAGTCTTACTCCATAGGGAATAAGAATATTTATGCTGCTTAGATAAT
ACCTCCTATAATTAATATTAATATAGCAATTATATGAAATATTAATTATTCGGAAAATAGCTATCATGTTTGAGAATTATGACCCAAAAGTAGGCTATAA
TTTTCAAACATGAAACAGCCCTG
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
1092 bp363 aa961187+No
ORF function : Transposase
Chemistry : Unknow

ORF sequence :

MLTSLIENLKEVKDFRKNQGKRYSLWEVLLVVVLGVMSGHQGYREMEYFVKANEVILKRTFNIYSQGMPSYSTIRRVMRGVDEKDLSKIVKEWSRENSPK
LKGIEGLAIDGKSLRSTVKDPGNQQQNMVIMVSLFSQETGLVLATEKFESKTGSEQAVAQGIIEECGLKGKLITADALHCNVTPVRKIIESENDYLIAVK
KNQIKLYNQIEKITKTTKAESIDTQKERGHGREITRRVSVFKNSIKIESPWEHIQSIIQVERWGYRGKKPYRETVYYISSIWEKADFFSKKIKGHWGIEN
QVHWVKDVLFKEDSMKIHQVQAATNWALLNTLGLNIFRGLGFLSITEGRRWLGNHWEKLVAIS

 

Blast result :
Comments
ISPlr1 is 51% aa similar to ISPto5.

McyDIS2 isolated from Planktothrix rubescens strain No178 was inserted into the microcystin (mcy) gene cluster leading to the inactivation of microcystin synthesis in Planktothrix spp.(pos. 11,918, AJ441056).
Planktothrix rubescens strains No139, 145, 161, 166, 169, 170 (AM039941-AM039947) contained almost identical IS elements (99.5-99.9% similarity) that were inserted at the same position of the mcy gene cluster (pos. 11,918, AJ441056).
Planktothrix rubescens strain No110 (mcyDIS1, AM039940) contained an almost identical IS element (99.3% similarity) that was inserted at the same position of the mcy gene cluster (pos. 11,918, AJ441056), however, mcyDIS1 was transcribed in the opposite direction.
Planktothrix rubescens strain No110 (mcyEGIS, AM055629) contained another almost identical IS element (99.9% similarity) that was inserted into the intergenic spacer region between mcyE and mcyG (pos. 23,822, AJ441056).

Planktothrix rubescens strain No40 (mcyAIS, AM039939) contained another almost identical IS element (99.0% similarity) that was inserted into the mcyA gene (pos. 41,274, AJ441056).
References
1] Christiansen, G., Kurmayer, R., Qiu, L., Börner, T. (2003) Appl. Environ. Microbiol. 72, 117-123.
Ostermaier, V., Kurmayer, R. (2008) Microb. Ecol. resubmitted after revision.