ISPpu21

  • Family IS5
  • Group IS5
MGE type ISRelated element(s) :
Isoform Synonym(s) ISPpuS12
Accession numberTranspositionOriginHost
FJ905320 Y Pseudomonas putida
Pseudomonas putida S12
Pseudomonas aeruginosa W368
Pseudomonas aeruginosa serotype 015-ATCC
DNA section
IS Length : 1190 bp

Ends


IR Length : 11/18

IRL : GGATGGTCTGAAAAAGACTTCCTGATTTGGCAAAATCCGCCGACTTCACC
IRR : GAAACTCTGAAGTAGCCACGTATTTCTGGCCGACTACAGACCTCGCTGTT

Insertion site


Left flankDirect repeatRight flankDR Length
CGCCTTTCGCCTTAGGGTATTGGA5
GTCCAGATCGCTAGCAAAACCACT4

DNA sequence

GGATGGTCTGAAAAAGACTTCCTGATTTGGCAAAATCCGCCGACTTCACCCGCAGAGCTTTCCGATGAAGCAGATGACCTTCGCCGACGCCGAGTACGCC
GGCAAGCGCAAGCAGACCCGCAAGGAACTGTTCCTGATCGAAATGGAACAGGTGGTGCCGTGGCAGGGCCTGATCGCCCTGATCGAGCCGCACTACCCGA
AGGGTGAAGGCGGTCGTCCCGCCTATCCGCTGATGGCGATGCTGCGCGTGCATCTGTTGCAGAACTGGTTCGGCTACAGCGACCCGGCGATGGAGGAAGC
GCTGTACGAGACGACCATCCTGCGCCAGTTCGCCGGGCTGAGCCTGGAGCGTATCCCCGACGAAACCACCATCCTCAACTTCCGTCGCCTGCTGGAGCGC
CACGAGCTGGCGGCCGGGATTCTGGCGGTGATCAATGGCTACCTGGGCGACCGTGGCCTGTCGCTGCGCCAGGGCACCATCGTCGACGCCACGCTGATCC
ATGCGCCGAGCTCGACCAAGAACAAGGACGGCAAGCGCGATCCCGAGATGCACCAGACCAAGAAGGGCAACCAGTACTACTTCGGCATGAAGGCGCACAT
CGGCGCCGACAGCGAATCCGGCCTGGTACACAGCGTGGTGGGCACGGCGGCCAACGTGGCCGATGTCACCCAGGTGGACAAGCTGCTGCACGGCGAAGAG
AACCTGGTCAGCGGCGATGCCGGCTATACCGGCGTCGAGAAGCGTGCCGAGCATGCAGGCCGCTCGGTCATCTGGCAGATTGCGGCGCGGCGCAGCACTT
ACCAGCAACTGAGCAAGCGCAGCCCGCTGTACAAGGCCAAGCGCAAAATCGAGAAGGCCAAGGCGCAGGTACGTGCCAAGGTCGAACATCCATTCCGGGT
GATCAAGCGCCAGTTTGGTTACACCAAGGTGCGCTTCCGTGGCCTGGCCAAGAACACCGCACAACTGATTACGCTGTTTGCGCTGTCGAATCTGTGGATG
GCGCGGCGGCATTTACTCGCGAACACAGGAGAGGTGCGCCTGTAACACGGCGAATAGCCGCTACGGGGTACGCGTAGCGGCTAAAAACCCTACATAAGAC
GACGATCTGAGCGCTTTTTGATCGATGGATCGCTTCAAAAAACAGCGAGGTCTGTAGTCGGCCAGAAATACGTGGCTACTTCAGAGTTTC
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
981 bp326 aa651045+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MKQMTFADAEYAGKRKQTRKELFLIEMEQVVPWQGLIALIEPHYPKGEGGRPAYPLMAMLRVHLLQNWFGYSDPAMEEALYETTILRQFAGLSLERIPDE
TTILNFRRLLERHELAAGILAVINGYLGDRGLSLRQGTIVDATLIHAPSSTKNKDGKRDPEMHQTKKGNQYYFGMKAHIGADSESGLVHSVVGTAANVAD
VTQVDKLLHGEENLVSGDAGYTGVEKRAEHAGRSVIWQIAARRSTYQQLSKRSPLYKAKRKIEKAKAQVRAKVEHPFRVIKRQFGYTKVRFRGLAKNTAQ
LITLFALSNLWMARRHLLANTGEVRL

 

Blast result :
Comments
ISPpu21 is 97% aa similar to ISThi1.
Others accession number : AF498406 - JX440360.
ISPpu21 element was found truncating the oprD gene of the Pseudomonas aeruginosa W368.
References
1] Jonathan Dennis . Direct submission (2009)
2] Yolanda Sáenz Domínguez. Direct submission (2012)