ISRhba4

  • Family IS481
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
NZ_AAXZ01000001 ND Rhodobacterales bacterium
Rhodobacterales bacterium HTCC2150
DNA section
IS Length : 1000 bp

Ends


IR Length : 24/35

IRL : TGTAGATATGTCGTTACTCGCGAGACATTTCCTTTAACCTCCCGTGATTG
IRR : TGTAAGGTGCGGTTACTGGTGAAACATCTTATTTGTTAATCATAACTTTT

Insertion site


Left flankDirect repeatRight flankDR Length
GCACCCAAGTGTTTGCGCAC0

DNA sequence

TGTAGATATGTCGTTACTCGCGAGACATTTCCTTTAACCTCCCGTGATTGGGAAGAAGGAGATGTAAATGAACAAGGATCAACGCGAGATACCGCGTAAA
TTGCGGGTTCTTCGATACGCCGAAGAGATTGGCCATGTTGCGAAAACTTGTAGGTATTTCGGGATCGGCCGCGCGAGTTTTTACAGATGGCGCAAGGCCT
ACTCAGAGCGAGGCGAAGCTGGCCTGATCAACGCACAACCCATCCCAAAATGGCACGCCAATAGGACGCCGCCCGAGCGCGAAGAAAAAGTGCTCTATCT
TCGTCGTAAATACCATCTCGGACCAATGCGGATCGTTTGGTATCTGGCGCGTTATCACAACATCAAGATATCTGATGCAACGGTTTCACGTATTCTGCGT
CGGCACGGGATAAACCGTCTTCCTCGCGGTACCCGCATGCGCAAGGTTCATACCAAGCGCTATCAGAAACAAGTCCCGGGTCATCACATTCAGATGGATG
TTAAGTTTCTGACTTTCATCGGTAAAGAAGGTGAGAAGGTACGTCGTTTCCAATACACAGCCATCGATGATGCAACGCGCGTTCGCGCCCTGAAGATCTA
TGAAAAGCACACCCAGGCCGACGCCATCGATTTCACGGATCACATCATTGAAAAGTTTCCTTTCCGCATCCGCGAGATCAGGACGGACAATGGCCATGAG
TTCCAGGCCAAGTTCCACTGGCATGTCGAAGACCTTGGTATCCGGTACGCTTACATCAAACGCGGGACACCTCAACTCAACGGTAAAGTCGAACGTTCAC
ACAGATCCGATGGAGAGGAGTTTTACCAGCTTCTTAGCTACAAGGGAGATGTTGATCTTGAAGCCAAACTGGACGAATGGGAGCGCTTCTACAATTTCCA
CAGACCCCATGGCGTCCACCCTGGAAAAACCCCTTACGAAGCGCTCAGAGAAAAGTTATGATTAACAAATAAGATGTTTCACCAGTAACCGCACCTTACA
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
894 bp297 aa68961+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MNKDQREIPRKLRVLRYAEEIGHVAKTCRYFGIGRASFYRWRKAYSERGEAGLINAQPIPKWHANRTPPEREEKVLYLRRKYHLGPMRIVWYLARYHNIK
ISDATVSRILRRHGINRLPRGTRMRKVHTKRYQKQVPGHHIQMDVKFLTFIGKEGEKVRRFQYTAIDDATRVRALKIYEKHTQADAIDFTDHIIEKFPFR
IREIRTDNGHEFQAKFHWHVEDLGIRYAYIKRGTPQLNGKVERSHRSDGEEFYQLLSYKGDVDLEAKLDEWERFYNFHRPHGVHPGKTPYEALREKL

 

Blast result :
Comments
ISRhba4 is 81% aa similar to ISRhba3.
References
1]Giovannoni,S., Vergin,K., Ferriera,S., Johnson,J., Kravitz,S., Beeson,K., Sutton,G., Rogers,Y.-H., Friedman,R., Frazier,M. and Venter,J.C.(2006) Direct Submission GenBank.

2] ISfinder annotation (2009).