ISPfr9

  • Family IS30
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
ND Propionibacterium freudenreichii
Propionibacterium freudenreichii
DNA section
IS Length : 1484 bp

Ends


IR Length : 21/22

IRL : TTCAACTGGTCGTCGCAACACCTTGATGTGAGAGGTGTGGAGGATGGCTA
IRR : TTCAACCGGTCGTCGCAACACCGGCTTCTTCCAAGGATCGTAGTTGCTCT

Insertion site


Left flankDirect repeatRight flankDR Length
TGTGGGCGCACCTGCCGTGG0
TGTGGGCGCACCTGCCGTGG0

DNA sequence

TTCAACTGGTCGTCGCAACACCTTGATGTGAGAGGTGTGGAGGATGGCTACCAAGCATTGGAGCATGAGGACTGGCGATGTCCCCGAGGGGTTGCGGCGT
CAGTGGCGAGCGGACAGGGCCTTGCGGCCGGCGATGTTCTCTCCGGGCAGGCCGCAACCGTCTCGGACGGTGCAGCGTGACTTCTGGCGTCTCATTGCGA
CGGGGATCTCAACGGCGGAGGCCGCGCTCGTGGTGGGTGTGTCGATCCCGGTGGCCTCGCGGTGGTTCCGCCACGCTGGCGGCATGCCACCGATCAGTCT
GGTCGAACCCAGTGGGCGATATCTCAGCTTCGCCGAGCGTGAGGAGATCGCCATCCTGAAGGCCCAGGGCAAGGGGGTTCGCACCATCGCCCGGGCTCTG
GGCCGTGATCCGGGCACGATCAGTCGTGAGCTGCGCCGCAACGCCGCTACCCGAGGCGGGAAACTCGAATACCGAGCCATGGTCGCCCAGTGGAAAGCCC
ACGAGGCCGCCAAGAGGCCCAAAGAAGCGAAGATGGTGACCAACCCGCGGCTGCGTGACTACGTCCAGGACCGGCTCGCCGGCAAGGTCACCCACCCTGA
CGGCCGCACCGTCAACGGCCCAGACACGCCAGTCTGGAAAGGGTTGAACAAGCCCCACCGGGCCGACCGTCGCTGGTCGAAGGCCTGGAGCCCGGAGCAG
ATCAGCCGCCGCCTGCGCATCGAGTTCGGTGATGATGAGTCCATGCGGATCAGTCACGAGGCGATCTACCAGTCACTGTTCATCGAGGGCCGCGGGGCGC
TGAAGCGGGACCTGGTGACCTGCCTGCGCACCGGCAGGGCTCTGCGCTCGCCGCGTGAGCGTTCGCGGAACAAGCCCCATGGCCATGTCACCGCCGATGT
CGTGATCAGCGAACGGCCCGCGGAGGCCGCGGATCGGGCTGTTCCCGGCCACTGGGAAGGCGACCTGATCATCGGCACCGGCCGCTCCGCGATCGGCACC
TTGGTCGAACGCCACAGCCGCGCCACGATCCTGGTCCATCTGCCTCGCTTGGAGGGCTGGGGCCAGACGCCGCCGGTCAAGAACGGCCCCTCGCTGGGCG
GTTACGGTGCGGTCGCGATGAACACCGCGCTCGCCGCGTCGATCACCGCTCTGCCGCAGCAGCTGCGCAAGACCATCACCTGGGACCGCGGCAAGGAACT
ATCCGCTCACGCCACCTTCGCCCTGGAGACCGGCACGAAGGTCTACTTCGCTGACCCCCACAGCCCATGGCAGCGGCCCAGCAACGAGAACACCAACGGG
CTGCTGCGTCAGTACTTCCCCAAGGGCACCGACCTGTCCCGCTGGACAGCAGAAGATCTGGAAGCCGTGGCCCACACCCTAAACAACCGCCCCCGCAAGA
CCCTCGGCTGGAGAACACCGGCCGAGGTCTTCGAAGAGCAACTACGATCCTTGGAAGAAGCCGGTGTTGCGACGACCGGTTGAA
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
1419 bp472 aa651483+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MRTGDVPEGLRRQWRADRALRPAMFSPGRPQPSRTVQRDFWRLIATGISTAEAALVVGVSIPVASRWFRHAGGMPPISLVEPSGRYLSFAEREEIAILKA
QGKGVRTIARALGRDPGTISRELRRNAATRGGKLEYRAMVAQWKAHEAAKRPKEAKMVTNPRLRDYVQDRLAGKVTHPDGRTVNGPDTPVWKGLNKPHRA
DRRWSKAWSPEQISRRLRIEFGDDESMRISHEAIYQSLFIEGRGALKRDLVTCLRTGRALRSPRERSRNKPHGHVTADVVISERPAEAADRAVPGHWEGD
LIIGTGRSAIGTLVERHSRATILVHLPRLEGWGQTPPVKNGPSLGGYGAVAMNTALAASITALPQQLRKTITWDRGKELSAHATFALETGTKVYFADPHS
PWQRPSNENTNGLLRQYFPKGTDLSRWTAEDLEAVAHTLNNRPRKTLGWRTPAEVFEEQLRSLEEAGVATTG

 

Blast result :
Comments
ISPfr9 is 74% aa similar to ISMsm8.
References
1] ISfinder annotation (2009)