ISPa34

  • Family IS110
  • Group IS1111
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
GU354325 ND Pseudomonas aeruginosa
Pseudomonas aeruginosa W37
DNA section
IS Length : 1216 bp

Ends


IR Length : 10

IRL : tttcatcGATCAATCACACGAAAAGGGGAAGTCGCCATGCAGTCTATTAC
IRR : ----gacGATCAATCACGACCAGCAGTGGCAACCAACTTGTTAGTCAGGC

Insertion site


Left flankDirect repeatRight flankDR Length
CATGATTGCAATGGCTAGGG0

DNA sequence

TTTCATCGATCAATCACACGAAAAGGGGAAGTCGCCATGCAGTCTATTACAGCCGGTGTTGACCTCGCAAAGCAGGTATTTGCCATTTGTCTCATGGATG
ATGCCGGTCATGTAACCGGCCGCCGTGAGCTTCGCCGAGATGGGTTTCATCAATGGCTTGCCGAGCAACCCGAAGGCATGATCGTCGCCATGGAGGCCTG
CAGCAGTGCTCACTACTGGGGCCGTGAATGCCAGCGTCACGGCTTGCAGCCACGCCTCATGGCCGCCCAATTCGTCAAACCCTTCCGCAAGCGGGCTTTG
ATCAAGAATGACCGGCAGGATGCCGAAGCCATTGCCACCGCTGCGCGCCAAGGCAATATGCGCTTCGTGGCCGTCAAGGATGAGCCACAGCAGGTGCGTC
TGAGCTGGCATCGCGTACGGGAGGGTTACAAGAAGGATGCCCTGGCCGTGCGCAATCGCTTGCGCGGTCTGCTGGCCGAGTTCGGTGTGGTTATCCCGGA
GTCAGTCACGGCACTCAAGCGCACCCTGGCTGATCTGGATCGCCATGAACTGCCAACCGGCCTGCTACGCCTGATCCGATTGCAGCAGGAACATCTCAAG
ATCATCGAGGCCGGCATGGCCGAATGTGATGCCCGCATTGCCGAGCAAGCCACAGCGGATGAACGCTGCCAGCGTCTACGCGCGCTGACCGGTATTGGCC
CGGTGACGGCAGATGCCGTAGTGGCCTCGGTCGGGAATGCGGCCGAGTTCCGCAACGGCCGCCAGTTCGCGGCCTGGATGGGTCTGACACCCACGCAGTT
CGGTTCGGGAGGCAAGGTCAGCCTCGGGCACATCAGTTGTCGGGGTGATCGTTACTTGCGTACCTTGCTAATACAGGGTGCTCGCAGCAGCCTGCAGCGA
GCGAAGCTGATACCAACCGACACAGCCACGCCAGAGCAGCAATGGATCGTGCAACTGGCAGCGCGCATGAGTTACGGCAAAGTGCTGGTCGCCATCGCCA
ACAAGCATGCACGACAGGTCTGGGCCATGTTGGCCCGCAGCGAGGCATACGATCCGGAGGCGTGGCTCAAGCACCCGATGGTGCAGCGAACCTGAGCCTC
GGGGAAACCGAGCAACAACATCCACGCCAGAGCACACGAGGTAACAACGGGTCAGACCGACCCGGAGAGAGCCTGACTAACAAGTTGGTTGCCACTGCTG
GTCGTGATTGATCCTC
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
1059 bp352 aa371095+No
ORF function : Transposase
Chemistry : DEDD

ORF sequence :

MQSITAGVDLAKQVFAICLMDDAGHVTGRRELRRDGFHQWLAEQPEGMIVAMEACSSAHYWGRECQRHGLQPRLMAAQFVKPFRKRALIKNDRQDAEAIA
TAARQGNMRFVAVKDEPQQVRLSWHRVREGYKKDALAVRNRLRGLLAEFGVVIPESVTALKRTLADLDRHELPTGLLRLIRLQQEHLKIIEAGMAECDAR
IAEQATADERCQRLRALTGIGPVTADAVVASVGNAAEFRNGRQFAAWMGLTPTQFGSGGKVSLGHISCRGDRYLRTLLIQGARSSLQRAKLIPTDTATPE
QQWIVQLAARMSYGKVLVAIANKHARQVWAMLARSEAYDPEAWLKHPMVQRT

 

Blast result :
Comments
ISPa34 has been detected inside an integron structure. ISPa34 is 62% aa similar to IS1618. According to the rules of this group of the IS110 family, IRs are not at the termini of the IS but at 7 nt on the left end and 3 nt of the rigth end.
References
1] Yolanda Sáenz (2009) Direct submission.
2] Rojo-Bezares B, Estepa V, de Toro M, Undabeitia E, Olarte I, Torres C, Saenz Y. (2011) J Med Microbiol. Jul;60(Pt 7):1053-1054.