ISRsp5

  • Family IS5
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s) NGRIS-8
Accession numberTranspositionOriginHost
NC_012586 ND Rhizobium sp.
Rhizobium sp. NGR234
Rhizobium sp. NGR234 plasmid pNGR234b
DNA section
IS Length : 1320 bp

Ends


IR Length : 14

IRL : CAGGCTGCTGAAAAAGCCCTGGCGCTTGGGTTGGATCAATGATTCCCTGC
IRR : CAGGCTGCTGAAAATCGTGTTGCGTTACCGCGAGATACTGCGGTGGGCGC

Insertion site


Left flankDirect repeatRight flankDR Length
GCAAAATGCTCTAGAACGACAGAT4
GCACTGCGCTCTAAGCAGCGCGTC4
CCACAATGCCCTAAAGCTCATCGA4

DNA sequence

CAGGCTGCTGAAAAAGCCCTGGCGCTTGGGTTGGATCAATGATTCCCTGCGGTTGCAACAGAGGGGACTGATTTGCATGCGCGGTGGGGACGACCGGACG
GGATCACTGTTTTCCTATGTCGACCTTGAGGCACGGGTTCCGGCCAGTCACCCGCTTCGGGTGATGCGCGCGCTGGTGAACGCTTCGCTTGTGGCGCTGG
ATGGGTCGTTCGCGGCGCTCTATGCGAAGAGGGGTCGCCCATCGATTGCTCCGGAACGGATGCTGCGGGCAGTGCTGTTGCAGATGCTCTATTCGATCCG
CTCCGAGCGTCAGTTGATGGAACGGCTGGAGTTCGACCTGTTGTTCCGCTGGTTCGTGGGCCTTGGGATCGACGATGCGGTGTGGGACGCCTCGACGTTT
TCGAAGAACCGGGACCGGCTGCTGACGACTAAGATCGCGCAGGGCTTCCTGTCGGCGCTGCTTTCGCAGCCGGCGGTGAAGAAGCTCCTGAGCGCCGAGC
ATTTCTCGGTCGACGGCACGATGTTGAAGGCGTTCGCCTCGATGAAGAGCTTCCGGGCCAAGGATGGCCCAAAGGGCGACAATGACCAGCCACCGGAAGA
CGGCCGCAACGGCGAGCGCGACTTCCGCAAGGAGAAGCGCTCGAACGAGACGCATGCCTCGACGACCGACCCGGACGCGCGGCTTTACCGCAAGGGCAAT
GGTCAGGAGAGCCGGCTGGCCTATCTGGGGCACGCGCTGATGGAGAACCGCAACGGCCTGGCGGTCGCCGGCATGGTGACGCATGCGACCGGCACCGCCG
AGCGGGAAGCGGCCACCGAACTGAGTGCGGACCTTGCCGAAGGCGCGACGCTTTGCGGCGACAAGGGCTACGACGCGGAAGCGTTCGTCGAGGGGCTGAA
GGACCGCAAAATCGTGCCGCATGTGGCGATCAACGGCACGGTGAGCAAGACCGGCAAGGTGCGCAAGACGGCAGTGCCGCCGCAGGTCGCGCAAAGTCCC
GGCTATGCGATCAGCCTGCGCTGCCGCAAGCGGATCGAGGAAATCTTCGGCTGGATCAAGACGACGGCCGGCTTCACCCAACTCAAGGTCCGCGGACTGG
ACAAGGTGAAGGCGGCCTTCACCTTCGCCCTTGCCGCCTACAACATCGTTCGTCTTCCGAAATTGCTCGGCTCGACGGGAGAAGTGTGCCTTGAGGGAGG
CAAATAGGCCAATATGACCGGAAAACCTGCCTTGACCGGCCTGTTTCCTGCCGATACCCGCCAGAAAACCGCGCCCACCGCAGTATCTCGCGGTAACGCA
ACACGATTTTCAGCAGCCTG
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
1131 bp376 aa771207+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MRGGDDRTGSLFSYVDLEARVPASHPLRVMRALVNASLVALDGSFAALYAKRGRPSIAPERMLRAVLLQMLYSIRSERQLMERLEFDLLFRWFVGLGIDD
AVWDASTFSKNRDRLLTTKIAQGFLSALLSQPAVKKLLSAEHFSVDGTMLKAFASMKSFRAKDGPKGDNDQPPEDGRNGERDFRKEKRSNETHASTTDPD
ARLYRKGNGQESRLAYLGHALMENRNGLAVAGMVTHATGTAEREAATELSADLAEGATLCGDKGYDAEAFVEGLKDRKIVPHVAINGTVSKTGKVRKTAV
PPQVAQSPGYAISLRCRKRIEEIFGWIKTTAGFTQLKVRGLDKVKAAFTFALAAYNIVRLPKLLGSTGEVCLEGGK

 

Blast result :
Comments
ISRsp5 is 74ù aa similar to ISMex28.
References
1] ISfinder annotation (2010)
2] Schmeisser,C., Liesegang,H., Krysciak,D., Bakkou,N., Le Quere,A., Wollherr,A., Heinemeyer,I., Morgenstern,B., Pommerening-Roser,A., Flores,M., Palacios,R., Brenner,S., Gottschalk,G., Schmitz,R.A., Broughton,W.J., Perret,X., Strittmatter,A.W. and Streit,W.R. (2009) Appl. Environ. Microbiol. 75 (12), 4035-4045
3] Streit,W.R., Schmitz,R.A., Perret,X., Staehelin,C., Deakin,W.J., Raasch,C., Liesegang,H. and Broughton,W.J. (2004) J. Bacteriol. 186 (2), 535-542