ISPna3

  • Family IS5
  • Group IS5
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
NC_008760 ND Polaromonas naphthalenivorans
Polaromonas naphthalenivorans CJ2 plasmid pPNAP04
DNA section
IS Length : 1425 bp

Ends


IR Length : 13/15

IRL : GTCCACCTGAAAAACACGCAAGCTCTTGATCTGTCTGGGGAATTTACGGA
IRR : GTCCACGCTGAACAATTCAGTTTTACGGCGCGACAGGAGAGACATGCAGC

Insertion site


Left flankDirect repeatRight flankDR Length
TCTTCAAGCCTTTGTAGCGCACTTTG6

DNA sequence

GTCCACCTGAAAAACACGCAAGCTCTTGATCTGTCTGGGGAATTTACGGATTGGTGAAGTTTGGATTTGCAGGAAAATAAATGCCATCCATTTGATTTCT
TGCAAATTTCGACAAGGTTTTCATGGGACCCAGACCGCGCACACCTCAGACGGACGAGTTGCCCCGTCCCCGCCTGGACGAGCAGCTCAAGATGAGCCAC
CCCCTGGTTCGGCTGGCCAACCTGATGAACTGGGAGGAGATCGAACGCAGTTTTGGCGCCCATTTCACTTCAAGCCGAGGGCGCCCTGCACTGAGTCCTC
GCCTGGTCGCGGGCCTGCTGTATCTGCAGCATGCCAACGACGCCAGCGATGAAGCGGTGGTGGCGACCTGGCTGGAAAACCCTTACTGGCAATACTTCTG
CGGCGAAACCTACCTGCAGACCGAGTTGCCCATCGACCCCTCCAGCCTGACGCGCTGGAGAAAGCGCATTGGCGAAGAAGGCGTCGAGGTCTTGCTGGCC
GTCACCATCGAAGCGGCCCGTGCGGCCGGCCTGATCAAGAAAAGCAGCCTGGACAAAATCATCGTCGATACCACCGTCATGCCCAAAGCCATCGCTCACC
CGACCGACAGCCGCTTGCTGGAGAAAAGCCGCCAGCACCTGGTCAGGCTCGCTGATGAACACAGTCTGCAGCTACGCCAGAACTACAACCAGCAGGCGCC
GCGCATGGCCGCGCAGATCGGCCGCTATGCCCATGCCAGGCAATTCAAGCGCATGCGCAAAACCCTCAAGGCGCTGAGAATCCGGGTGGGCCGCGTGTAC
CGTGAAGTCACTCGCAAGCTCGCTCAGCTGCCAGAGCAGGCGCGGCACAAAGCCCGGGACCTGCTGCACCGCGTGGGCCGCATCCTGACGCAACAGCCCA
GGGACAAGAACAAACTGTATGCGCTGCACGCACCAGAGGCAGAGTGCATCTCGAAGGGCAAGGCCAGAACGCCCTACGAGTTTGGGGTCAAAGTGACGAT
TGCCACCACGCTCAAGGAGGGCCTGGTGGTCGGGATGCGCAGCATGCCGGGCAATCCGTATGACGGGCACACGCTCGACGAAGCCATTGAGCAGGTCGAA
ATCCTCGCCGAGCAAAGGCCCGGCATGGCCATCGTGGACAAGGGCTACCGGGGCGCGCAGGTCGAGGGAGTACAGATTCTGCGCTCAGGCCAGCGCCGGG
GCGTCACCCGAGCCATGAAGGCGATGATCAAGCGGCGAAGTGCCATTGAGCCGACCATTGGGCACATGAAGATGAAGGGACGGCTGGCCCGAAATCCGCT
CAAAGGTACGCTGGGTGACGCCTTGCACGCCGTGCTGTGCGGCGCGGGCCACAACATCCGGCTGATGCTCAAGAAGCTGCATGTCTCTCCTGTCGCGCCG
TAAAACTGAATTGTTCAGCGTGGAC
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
1281 bp426 aa1231403+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MGPRPRTPQTDELPRPRLDEQLKMSHPLVRLANLMNWEEIERSFGAHFTSSRGRPALSPRLVAGLLYLQHANDASDEAVVATWLENPYWQYFCGETYLQT
ELPIDPSSLTRWRKRIGEEGVEVLLAVTIEAARAAGLIKKSSLDKIIVDTTVMPKAIAHPTDSRLLEKSRQHLVRLADEHSLQLRQNYNQQAPRMAAQIG
RYAHARQFKRMRKTLKALRIRVGRVYREVTRKLAQLPEQARHKARDLLHRVGRILTQQPRDKNKLYALHAPEAECISKGKARTPYEFGVKVTIATTLKEG
LVVGMRSMPGNPYDGHTLDEAIEQVEILAEQRPGMAIVDKGYRGAQVEGVQILRSGQRRGVTRAMKAMIKRRSAIEPTIGHMKMKGRLARNPLKGTLGDA
LHAVLCGAGHNIRLMLKKLHVSPVAP

 

Blast result :
Comments
ISPna3 is 87% aa similar to ISUnCu2.
References
1] ISfinder annotation (2010)
2] Yagi,J.M., Sims,D., Brettin,T., Bruce,D. and Madsen,E.L. (2009) Environ. Microbiol. 11 (9), 2253-2270