ISLca2

  • Family IS5
  • Group IS5
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
NC_010999 ND Lactobacillus casei
Lactobacillus casei BL23
DNA section
IS Length : 1563 bp

Ends


IR Length : 13/20

IRL : GTGGCTGCTTAAAAATTCTATAATTCAGGCAGTTAAGCTAATATATGCAT
IRR : GTGGCTGTTGAACTAGGCCACCATATCTTCGACCCTTGTAGTAAATTTAT

Insertion site


Left flankDirect repeatRight flankDR Length
TGGGATCAACTAAATAAGTACCTTAT6
GAAAACGCCTTTATTAGGCTCTGCTG6
AATGGTCGCCTATGTAGCTGATAATT6
TTTTGTTTCATACCTAATGAAAACTT6

DNA sequence

GTGGCTGCTTAAAAATTCTATAATTCAGGCAGTTAAGCTAATATATGCATTATTGCGGTATAATAAATCCATTGGAATTAGCTGCTTTCCTGCATTTTCC
TTGCATTTTTTGGGAACCTACTCGGAGGTTATCGTATGGTCTATCGTCACAGCCCGCTTCAATTGTCATTTGAATCCTTTGGTGCCGGTTTAAGTACCCC
ACTTAGCTCTAACAATGAGTGGGTCCAGTTGGCGGAGGTCATGCCCTGGAAAGCTCTCGATGAGGCATACCAATTGGAGTTCACCAAAAATGCGGGACGT
GCGGCAAAACCATTTCGTTTACTCTATGGGGCAATCCTGATCCAACAACGGATGGGTTTAACTGATCGTGGGGTGGTTGCGGCAATTCGTGATACACCCG
CACTTCAATATTTCATCGGGTTGTCCGAATACAAAGCGGTTGAGCCGTTCAATTATTCCAGCCTGGCACACTTTCGCAAACGAATTGCCGATATCTCCGA
GCTGATTACGAATATCATGAATGATACAGTACGCGCCAAGATCGAAGCGTTGGTCCCATTCAAAGTGGACACCGTCATCACGGACGCAACCGCAGTGCCA
GTCAAAATCAAGTATCCTCAAGACACCGTCCTCCTCAACCAAGCAAGGCTGAATCTTGAGGCGATGGCGATCGATATGGCACACCAACTTGGTGTGCCAA
ACCCACGCATGTACAAACGCGAGGCGAAGCATTGTTGGACCTCATTTTCACGACATCCAAAGCAACAGCGTGGTGGCTTTCATAAACAGGTCAAGGCCCA
ACTTCAATATGTGCGCCGTGATTTGCGGTACATCAACGAATTCATCGATCAGGGTGCGACTCTACCAGATGAACAAGCGATTCGCTTAGGCGTGATTCGA
ATTCTATTTGACCAGCAATGGTACATGTATACCCACAAGACTCACCACGTTGAAGACCGAATTGTTAGTCTCCAACAGCCGTACATTCGCCCAATTCAAC
GTGGTAAGGCCAATGCTAAAGTTGAATTTGGGGCGAAGATTGACTGTTCGTTAAGTGAAGGCGTAGTCGACATTGAACGTTTTGATTTCACCGCATTCTC
TGAGGGCCAAGACTTCGCGGAAACTTTAGACCACTATTACGACCTTCATGGGCATTATCCGGACGAAGTACTGGCCGATACGCTGTACCGTAATCGGGAG
AACCTAAAGCTGTGTAAGGATTTGGGTATCCGAATCTGCGGTCCGAAGCTTGGCCGGCATCCAAAACACGTTGATGCAGCGAAACGGCGTGAGGATACTG
ATGCCGAGAATCGAAGAGGTACCATTGAACGCCGGTTTGCTTTTATGAAGGGCACGCTGGGGCTTGACTTGGTGAACACTCGGACAGCTGAATCACTGGC
CGTCAAGATTGACGTGGCCATCGTCTTGAGCAATGTGCTGACCCTGTTAAGGGTATTTGCTATACCAATTTTAATTTTGGCTAAATTCGAGGGTGAGGCC
TATCAAATTCGCTATAAATTTACTACAAGGGTCGAAGATATGGTGGCCTAGTTCAACAGCCAC
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
1416 bp471 aa1361551+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MVYRHSPLQLSFESFGAGLSTPLSSNNEWVQLAEVMPWKALDEAYQLEFTKNAGRAAKPFRLLYGAILIQQRMGLTDRGVVAAIRDTPALQYFIGLSEYK
AVEPFNYSSLAHFRKRIADISELITNIMNDTVRAKIEALVPFKVDTVITDATAVPVKIKYPQDTVLLNQARLNLEAMAIDMAHQLGVPNPRMYKREAKHC
WTSFSRHPKQQRGGFHKQVKAQLQYVRRDLRYINEFIDQGATLPDEQAIRLGVIRILFDQQWYMYTHKTHHVEDRIVSLQQPYIRPIQRGKANAKVEFGA
KIDCSLSEGVVDIERFDFTAFSEGQDFAETLDHYYDLHGHYPDEVLADTLYRNRENLKLCKDLGIRICGPKLGRHPKHVDAAKRREDTDAENRRGTIERR
FAFMKGTLGLDLVNTRTAESLAVKIDVAIVLSNVLTLLRVFAIPILILAKFEGEAYQIRYKFTTRVEDMVA

 

Blast result :
Comments
ISLca2 is 53% aa similar to ISAcma17.
References
1] ISfinder annotation (2010)
2] Maze,A., Boel,G., Bourand,A., Loux,V., Gibrat,J.F., Zuniga,M., Hartke,A. and Deutscher,J. (2008) Direct submission GenBank.