ISLrh2

  • Family IS5
  • Group IS5
MGE type ISRelated element(s) :
Isoform Synonym(s) IS11
Accession numberTranspositionOriginHost
FJ428614 ND Lactobacillus rhamnosus
Lactobacillus rhamnosus ATCC 53103
Lactobacillus rhamnosus GG
DNA section
IS Length : 1575 bp

Ends


IR Length : 10/15

IRL : GTGGATGGTGAAAAACTATAAAAGTACTTTAATAATAGGATTTACCAATA
IRR : GTGCCTGGTGATTTAGGCTGCGGTTTCTGGCCGAATTTCAGTCACTTTAT

Insertion site


Left flankDirect repeatRight flankDR Length
AATCAATGTATAATTAAGCTTGTTTT6
AAGAAGTACCTAAATACGGCGATAGT6
GACTCAATATTAGTTACAAAGTACAG6
TAATAGCTGATATTTAGGGTCTTTAA6
ATGACTTTGCTAATTAAGCCTCACAT6
ATATCCCACTTATTTAGTCAATGGCT6
CATCAATGGCTAATTTAATTTTCGAA7
AAAAAGCGCTTAAATAAACATATGCA6
TGAATTTTCCTATATAATAACTGGTC6
AGCTAAAACGTAAATAGTCTTCATAA6
GCTAGTTGTATACTTAGTGTGTAGGT6
TCGTAAGTGGTAATTAGTGACTCAAT6
TATTTAAAACTATTTAGTAAAGGCCT6
TTGCTGCCATTATTTACATCGGCATC6
TCAGTCTGCTTAGTTACTCAGCAAAT6
AACTTCTCTCTAGGTATGGTAATAAA6
TCAGTTGATATCCCTAAATATAGTTATAATGAAAGAAATA0
AAAACAAAACTAGATTAACTAATTCA7
AACTCGCGCTTAAATAGTGAATCGTC6
CCACAAACAATATTTAGGAGATGTGC6
GGTTAGCAGATATTTATGATTTTCTT6
CTCCCCTTGATACGTAGGCAACTCCC6

DNA sequence

GTGGATGGTGAAAAACTATAAAAGTACTTTAATAATAGGATTTACCAATAGTTCGGCGTATAATAAGTGCAACCCTTATTTGCCCGAAATGCCTATGCTT
TGGGATTTACCCTTGCACTTATCGCTGACCTATCGGAGGAATTGATCATGGTTTATCGTCAAAAAGCAACGCAACTGTCACTTGAATCCTTTGGAAGCGC
TCTGGGAACACCGCTCAGCCCGGACAACGAGTGGGTTCAATATGCAGAATTGATCCCATGGGCCAAACTTGAAGAGGCATACCAATTACAGTTTCCTTCA
AAAACCGGCCGAGCAGCGAAGCCATTTCGATTGCTTTATGGCGCAACGTTGATCAAGTTGAAGAAAGGCCTGACCGACCGCCAAGTTGTCGACGATATCC
GTGATACACCAGCCTATCAGTACTTCATCGGGTTACCCGAATATCGCGCTAAGAAGCCATTTGAACACACAACGTTGGTGCACTTTCGCCAACGGCTTTC
AGCCATCTCAGATTTGATCCGCAACATTACTAATGACTTCACGCGCGAGCGGTTGGAGGCCGATCTACCTGAGGGGACGCATGTTTTGATTAGTGATGCG
ACTGCCGTTCCGGTCAAGATCAAGTATCCCCAAGATACAACGCTGCTTAACCAGAGTCGTTTGAATCTCGAACAAATGGTCACAGATCTGGCCCACGGGT
TAGGTGTGGAAATTCCGCGGACATACAGACGTGAAGCAAAAGGTAAGTGGACCGCTTTTTCGAGGAAACCGCGGCGTCAAAACAAGGAACGCCGCAAACA
GCTTCAAGCTCAGCTACAATACATCCGAAGAGATCTGCGATATGTGGCGGAACTGCTTGCGCAAGGCGGTCAGCTCACTGATTGGCAAGCACAGCGTCTG
GAAGTGATTAAACAAGTCTATGAGCAGCAGCTCTTCATGTTTGAGAACCACACTCACCATGTCGAGAATCGCATCGTTAGCCTTCAACAGCCGTATATCC
GGCCAATCGTGCGAGGTAAGGCAAAGCAGTCCGTTGAGTTTGGCGCCAAGATTGACTGTTCCATGTTGGATGGCGTGATTGATGTAGAGCGTTTCGACTT
CAATTCATTTAACGAAAGCACTGATCTTGAAGTAACGCTTGACCATGCTTTTGACCTAGTGGGTGAATATCCGGATGAGGTGCTGGTCGATACTCTCTAT
CGCACGCGAGATAACATCAATCTGTGTAAGAAGCTAGGCATTAAACTTAATGGGCCAAAGCTGGGTCGAAAGCCCAAACATGTGGATCCGAAACAGCGCA
AAGCCGATGTCAGTGCGGAAAATCGTCGGGGTGCCATTGAGCGCAAGTTTGCCTTCTTGAAAGGTTCACTTGGGCTTGACTTAGTGAACACCAGAACGGC
TGAGTCCTTGGTGGTAACGGTGGATAGCGCGATTGCATTGGCAAATATCGACCTCCTCCTTAAGCTTTTTTCTGTACCAATTTCTATTGTGGTCGAACAG
GGTGGCCTGCATTATCAAATCAACTATAAAGTGACTGAAATTCGGCCAGAAACCGCAGCCTAAATCACCAGGCAC
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
1497 bp498 aa671563+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MQPLFARNAYALGFTLALIADLSEELIMVYRQKATQLSLESFGSALGTPLSPDNEWVQYAELIPWAKLEEAYQLQFPSKTGRAAKPFRLLYGATLIKLKK
GLTDRQVVDDIRDTPAYQYFIGLPEYRAKKPFEHTTLVHFRQRLSAISDLIRNITNDFTRERLEADLPEGTHVLISDATAVPVKIKYPQDTTLLNQSRLN
LEQMVTDLAHGLGVEIPRTYRREAKGKWTAFSRKPRRQNKERRKQLQAQLQYIRRDLRYVAELLAQGGQLTDWQAQRLEVIKQVYEQQLFMFENHTHHVE
NRIVSLQQPYIRPIVRGKAKQSVEFGAKIDCSMLDGVIDVERFDFNSFNESTDLEVTLDHAFDLVGEYPDEVLVDTLYRTRDNINLCKKLGIKLNGPKLG
RKPKHVDPKQRKADVSAENRRGAIERKFAFLKGSLGLDLVNTRTAESLVVTVDSAIALANIDLLLKLFSVPISIVVEQGGLHYQINYKVTEIRPETAA

 

Blast result :
Comments
ISLhr2 is 76% aa similar to ISLca2.
References
1] Lebeer,S., Verhoeven,T.L., Perea Velez,M., Vanderleyden,J. and De Keersmaecker,S.C. (2007) Appl. Environ. Microbiol. 73 (21), 6768-6775
2] Lebeer,S., Verhoeven,T.L., Francius,G., Schoofs,G., Lambrichts,I., Dufrene,Y., Vanderleyden,J. and De Keersmaecker,S.C. (2009) Appl. Environ. Microbiol. 75 (11), 3554-3563
3] Morita,H., Toh,H., Oshima,K., Murakami,M., Taylor,T.D., Igimi,S. and Hattori,M. (2009) J. Bacteriol. In press