ISRxy1

  • Family IS1182
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
NC_008148 ND Rubrobacter xylanophilus
Rubrobacter xylanophilus DSM 9941
DNA section
IS Length : 1790 bp

Ends


IR Length : 15

IRL : GCGTGGCCGAAAACCTCCATGGGTTGGCCGCTTGAGTACACTCCCCGCAA
IRR : GCGTGGCCGAAAACCCAGGCTCCGAGCGGGGCGATAGAGTAGCGAAAACC

Insertion site


Left flankDirect repeatRight flankDR Length
CCAGGTCAAGTC/TCTAGAAGTTCTGTAATTTCC8

DNA sequence

GCGTGGCCGAAAACCTCCATGGGTTGGCCGCTTGAGTACACTCCCCGCAAGATAGATATATGAGGAGGTGCTCGCGATGCTCGGCAGGCAATCGGATCTA
GCCGGTGGCGGGCACCCCTACCTCGACCACGTGCGACGGGACTCTTTCTACGGCTTCCTCGCTTTGCACCGGCAAGAGTTGTTCTCTGACGAGGACTTCG
CCGAGTTCTACTGCCCGGACAACAGGCGCCCGAGCGTCCCCCCGAGCCTGCTGGCGACGGCGCTGCTCTTGCAAGCCTACGAAGGCGTCTCCGACGAGGA
GGCCAAGGCGCGGGCGGACTTCGACCTGCGCTGGAAGGTCGCGCTGGGCGTAGGTTTGAAGGAGCGGCCTTTCGCCAAGAGCACGCTGCAGTTGCTTCGG
GCGCGCCTGATCATCAACGAGCGTATGCGAACGGTTTTCCGCAGGAGCCTGGACTTCGCTCGCCATACAGGCTACCTCCCGAGCCGCAGGCTCAAGGTCG
TTCTGGACACCAGCTACGTCCTGGGCCGGGGAGCGGTCAAGGACACCTACAATCTGCTGGCCGACGGGATCGTCATGCTGGTGCGGGAACTGGCCGCCGG
GGCATGCTCAGACCCGGAGCAATGGGCGCGCGAGCGCGGCCTGGGACGCTACTTCGGCTCGTCTCTGAAGGGAGAGGCGGGCATCGACTGGGACGACCCC
GAGGCCCGGCAAGCGTTCCTGGAAGGCGTGGTCGCGGACGCGGATCGCTTGCTGAAGGTGGCCCGAGAGGCGGTGGAGGGTTCTACTGCGGGCGATCCCG
AGCTTCGCTGCGGGCGGCTGCGTGATGCGGCGCTTCTGTTGGAGCGACTGCTGATGCAGGACATCGAGCGCCGGGAAGACGGGGCTCGTCTCAAGCAAGG
AGTCAGCCCGGATCGGGTGGTCTCGGTGCACGACCCCGAGATGAGGCACGGTCGCAAGAGCGAGAGGCGACGTTTCGACGGGCATAAGGCGCAGGTCGCG
GTCGATCCCGAGAGCCAGTTGATCACGGCAGCGGACGTTCTGGCGGGCAACGCCCCCGACCACGAGCGGGCGCTGGAGCTGGTCGAACAGGTGGAGGCGA
ACGCCGACGCCGTGGTCGAGGAGGTGGTAGGTGACTGCGCCTACGGGGACGGCGACACCCGCAAAACCTTCGCCGAGGCCGGGCGGAGGCTCGTAGCGAA
GGTAGCGACAAGGCGCGGGGTCACCCAGTTCCCCAAAGAGGACTTCCGGATCGATCTGGAAGAGATGAGTTGCGCGTGCCCCGCGGGTCAAAAGACACGG
AAGGTGGTGTCGATCAGTTCGGGCGATCGCTACGGCGCTCCGGGCGTCCCCTTACGGGCATTTCGCTTCGACGCGGCCATCTGCGACGTATGCCCGCTCA
GGTCCTCGTGCGTGCGAGCGCACGTCGGCAAGGGTCGGCTGGTTATGATCCACCCGCAGGAAGCTCTGCTGCAAGAGGCGAGGGCATTCCAGCGAAGCGA
GGCGTTCGCGCCGTACCGCGAGCTACGTCAAGCAGCCGAGCACAGGCTGGCTCGGCTGATGCAACTCGGCGTTCGCCAGGCACGCTACTTCGGTCGGACG
AAGACGCTCTTCCAGCTCCTTATGGCCGCGACCGTCGCCAATCTTACGCTCGTGGCGACGAGGGTCGGCCTCATGCGAGATCGCAACCACCCTCAGACGA
TTATCTCCATACATGTCCACGCTTTGTTTATGGTTCGCCGGGTTTTCGCTACTCTATCGCCCCGCTCGGAGCCTGGGTTTTCGGCCACGC
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
1731 bp576 aa771807+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MLGRQSDLAGGGHPYLDHVRRDSFYGFLALHRQELFSDEDFAEFYCPDNRRPSVPPSLLATALLLQAYEGVSDEEAKARADFDLRWKVALGVGLKERPFA
KSTLQLLRARLIINERMRTVFRRSLDFARHTGYLPSRRLKVVLDTSYVLGRGAVKDTYNLLADGIVMLVRELAAGACSDPEQWARERGLGRYFGSSLKGE
AGIDWDDPEARQAFLEGVVADADRLLKVAREAVEGSTAGDPELRCGRLRDAALLLERLLMQDIERREDGARLKQGVSPDRVVSVHDPEMRHGRKSERRRF
DGHKAQVAVDPESQLITAADVLAGNAPDHERALELVEQVEANADAVVEEVVGDCAYGDGDTRKTFAEAGRRLVAKVATRRGVTQFPKEDFRIDLEEMSCA
CPAGQKTRKVVSISSGDRYGAPGVPLRAFRFDAAICDVCPLRSSCVRAHVGKGRLVMIHPQEALLQEARAFQRSEAFAPYRELRQAAEHRLARLMQLGVR
QARYFGRTKTLFQLLMAATVANLTLVATRVGLMRDRNHPQTIISIHVHALFMVRRVFATLSPRSEPGFSATLLEVL

 

Blast result :
Comments
ISRxy1 is 40% aa similar to ISMno10.
The STOP codon is in the insertion site (17 bp after the end of the IS).
References
1] ISfinder annotation (2010)
2] Copeland,A., Lucas,S., Lapidus,A., Barry,K., Detter,J.C., Glavina del Rio,T., Hammon,N., Israni,S., Dalin,E., Tice,H., Pitluck,S., Munk,A.C., Brettin,T., Bruce,D., Han,C., Tapia,R., Gilna,P., Schmutz,J., Larimer,F., Land,M., Hauser,L., Kyrpides,N., Lykidis,A., da Costa,M.S., Rainey,F.A., Empadinhas,N., Jolivet,E., Battista,J.R. and Richardson,P. (2006) Direct submission GenBank.