ISLlo2

  • Family IS1182
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
NZ_ACZG01000001 ND Legionella longbeachae
Legionella longbeachae D-4968
DNA section
IS Length : 1479 bp

Ends


IR Length : 36/39

IRL : GTTTGTGAAAGATAAGGTACCGGCCTGTTGTAAAAGATGAGGAAACTTTA
IRR : GTTTGAGCTAGATAAGGTACCGGCCTGTTGTAAAAGATGCGCTATTTTTG

Insertion site


Left flankDirect repeatRight flankDR Length
TTTCCCAATTATACCCTGATAACACGCCTCA0

DNA sequence

GTTTGTGAAAGATAAGGTACCGGCCTGTTGTAAAAGATGAGGAAACTTTACACACTCTGATAAAAAGGATCTAATCCATCAATTTTAATTGAATAACAAG
AAGTTAAATGCAAGGAAGAATTCTCGACAAATCCCAACATACTGATTATTTATCACTGGATAAACTAATACCTAAAAAGCACTATTTAAGAAAAGTTAAT
GAATGCATCGACTTTTCATTTATTGAAGAGATTACCGAGTCTTGCTATTGCCCCAATAATGGAGGTCCTTCAGTTGCACCAGAATTATATTTTCGAATGA
TGCTGATAGGTTATATATTTTCCATCAAATCGACAAGACAACTAGTTCAAGATATTCATTATAATATTTGCTACCGATGGTTTTGTGGATTAACACTAAA
TGACTCTATTCCCCATCACGCAAGTTTGAGTCGCATTAAAAAACGCTATACGATTGAGGTTTTCGAAAAATTTTTTCAATCCATTGTCGAACAATGTCAG
CAAGCTGGTCTTCTTCAAAGCCAGAGTGTGATGACAGATAGTACGTTAATTCAAGCAAATGCCTCGTTGAACTCGATGAAGCCATTAAATAAAGAAGTTC
CTAAAAATATAAAACCATCTAAAGATGGCATCTCTGAAAATAAGTGGCATATTTCTAATAAAACTCATCGGAGCAAAACCGATCCTGATGCAATGTTAGC
TTTTAAATCAGGAACATTAAGAAGTTTAAAATATAAAGCACATGTGTGTTGTGATAGTAAAAGCCGTGTAATTAGTGCCATAAAGATTACAACTGGAGCA
GTACATGACTCTCAGCCTTACTTAGACTTAATAGTTCAATTAAAAAATAAATTAATGTTGAGAGAAGTTATAGCAGATAGAGCATATGGTTCTGGAGAAG
TTATTTCATCCCTGAATGATATGGGTATCCAAGAATTTATACCATTATTTACTACACGTAGTGGTAAAACTCCTGATAAAGAAATACATGGAATTAATTA
TGATGAGATTAAAAAAACTTATATTTGCTTTGCAAATATTGAATTTAAACCAGGAAAAATAAATTCCGAGGGTTATATTTCTTATCGTACCCATACAAAA
GATTGCCGTGAATGCTCTTTAAAAGCAATTTGCCAAGTGCCTCAAATGAAGAATAGAGACATTCGAGTTATGGCACGGCATATTCATGCCGATTTATTTC
AAAAAGTGAAAATTAAAATGGAAACTGAGGAATTTAAAGAAAAATTTCGAGAACGTTTATGGAAAATTGAAGGTGTTATGAATGAATTAAAAAACTATCA
TTGCCTTTCAAAAGCGAAGTATCGTGGTCTTGATAATATGCAGATCCAGGCCTACATAGCTGCTGTAGTGATTAATATTAAAAGACTTGTTAATTTTCTG
TTGTTTTCAGTTATATCACATTGCATGATCAAAAATAGCGCATCTTTTACAACAGGCCGGTACCTTATCTAGCTCAAAC
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
1365 bp454 aa1081472+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MQGRILDKSQHTDYLSLDKLIPKKHYLRKVNECIDFSFIEEITESCYCPNNGGPSVAPELYFRMMLIGYIFSIKSTRQLVQDIHYNICYRWFCGLTLNDS
IPHHASLSRIKKRYTIEVFEKFFQSIVEQCQQAGLLQSQSVMTDSTLIQANASLNSMKPLNKEVPKNIKPSKDGISENKWHISNKTHRSKTDPDAMLAFK
SGTLRSLKYKAHVCCDSKSRVISAIKITTGAVHDSQPYLDLIVQLKNKLMLREVIADRAYGSGEVISSLNDMGIQEFIPLFTTRSGKTPDKEIHGINYDE
IKKTYICFANIEFKPGKINSEGYISYRTHTKDCRECSLKAICQVPQMKNRDIRVMARHIHADLFQKVKIKMETEEFKEKFRERLWKIEGVMNELKNYHCL
SKAKYRGLDNMQIQAYIAAVVINIKRLVNFLLFSVISHCMIKNSASFTTGRYLI

 

Blast result :
Comments
ISLlo2 is 49% aa similar to ISBth7.
References
1] ISfinder annotation (2010)
2] Kozak,N.A., Buss,M., Frace,M., Govil,D., Lucas,C.E., Travis,T., Olsen-Rasmussen,M., Benson,R.F. and Fields,B.S. (2010) J. Bacteriol. In press