ISLpn11

  • Family ISL3
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
NC_006368 ND Legionella pneumophila
Legionella pneumophila Paris
Legionella pneumophila subsp. pneumophila Philadelphia 1
Legionella pneumophila Corby
DNA section
IS Length : 1286 bp

Ends


IR Length : 20/24

IRL : GGCTCTACCCCAATTAAGGGGGCATTTTAATCAAGTTAGCATAGACTAAC
IRR : GGCTCTTCCCCATTTCCGGGGGCACTAATCAAGAACACAAAACTTTAACC

Insertion site


Left flankDirect repeatRight flankDR Length
AGGATCTTGCAATTAATTCATTTATAAA8
AACTCATTCCGCCACCTGTTATGGATCA8
TGTTGCGTAATCCAAATTTGAGAATGCC8
TTCATTACAATAGATTCTGCGAAGTGCA8
CTTGCACCGCTTATGg/aATACGCCTATTG10
GCTTATGGATGTCTACATTG0
GAAAGATGAAGATAATTATA0
TATAAGTTTTGATATAATTT0
TCAAAACTTGAAGACCCCTT0

DNA sequence

GGCTCTACCCCAATTAAGGGGGCATTTTAATCAAGTTAGCATAGACTAACTCTTTGATTTGACGGTCAAAAGGAAGATTAAAATGCCCAAGAAAGATTGT
ATCCTAAATTTACCAGGATATTCTATTAAAAAGGTGAGTGGAGAGAACCCGGTTTATATTGAAGTGAGTTATCGCCGGGTAGTTCGGTGTATTCATTGTG
GTAATAAGAAGTTACGTAAAAAAGACAGTTTTATAAGACGCATACGTCATGAGTCGATTGGATTAAGACGCAGTTACTTGTGTATCAAGGCTCATAAATA
TTATTGTCCTGCGTGTGGTCGCTATTTTAATCAGCGTTTTCCTGGGATAGGCAAGTATCAAAGAGCGAGCGAGAGTTTGCGTAAACAGGTATTTCATTAT
CACAGCAAAGGAGTGAGTCAAAAGGATTTGGCTCGTGATTTAAAGCTGGGTAAGTCGACTGTAGAGCGCTGGTATCATTATGGTTATGAGCTTCGCTATA
AGAAGATAGCGACACGTTCCTGTCCCCGAGTATTAGGACTTGATGAACATTCATTTAATCGGAAAGTGGGTTATGCCACAACCTTTTGTGACTTGGCCAA
ACATAAAATATTTGATGTGGTTGAGGGGCGTTCAGAAAAGGATTTAGAAGGTTATCTAAACACGTTAGAAGGAAAAGATAAGGTACAGGTAGTCTGTATT
GATTTAAGTTCCAGTTATCGCAAGTTAATCAGGCGTTACTTTCCCAATGCGATGATTGTTGCCGATCGCTTTCATGTGATACGTTTGTTGAATCAATTCT
GTTTACAGACTTATCAGCAGATTGACCCTGAGATGAAATATCAGCGAGGTCTATTGGCAGCACTGAGAACCAATCCCAATAATCTCACTGTAAAACGACT
CAATAGACGGGAACGTTATTTGCAACAACAGCCTGTCATTGCTGCAATATATTACTTTAAACAGCGATTACATCGATTACTCATGCGAAAACATCGCACC
GCAAAGCAGTGTACGCGTTTAATCCCTCTCTTTCTTAAACTGGTTGCCAGTTTGAAAGAAAGTCCTTTCGACTCACTAAAGACTCTAGGTAAAACATTAT
ATCAATGGCGGGAAGAAGTGGTTAGAATGTGGCGGTTTACTAAAAACAACGGTATTACGGAAGGGTTTCATCGGAAGATGAAGCTGATTCAAAGACGTGC
TTATGGATTTAGAAATTTTGAAAATTATAGGTTAAGGGTTAAAGTTTTGTGTTCTTGATTAGTGCCCCCGGAAATGGGGAAGAGCC
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
1176 bp391 aa831258+No
ORF function : Transposase
Chemistry : Unknow

ORF sequence :

MPKKDCILNLPGYSIKKVSGENPVYIEVSYRRVVRCIHCGNKKLRKKDSFIRRIRHESIGLRRSYLCIKAHKYYCPACGRYFNQRFPGIGKYQRASESLR
KQVFHYHSKGVSQKDLARDLKLGKSTVERWYHYGYELRYKKIATRSCPRVLGLDEHSFNRKVGYATTFCDLAKHKIFDVVEGRSEKDLEGYLNTLEGKDK
VQVVCIDLSSSYRKLIRRYFPNAMIVADRFHVIRLLNQFCLQTYQQIDPEMKYQRGLLAALRTNPNNLTVKRLNRRERYLQQQPVIAAIYYFKQRLHRLL
MRKHRTAKQCTRLIPLFLKLVASLKESPFDSLKTLGKTLYQWREEVVRMWRFTKNNGITEGFHRKMKLIQRRAYGFRNFENYRLRVKVLCS

 

Blast result :
Comments
Copy number in L. pneumophila str Paris is 7, str Philadelphia is 1 and Corby 1.
ISLpn11 is 45% aa similar to ISFnu5.
References
1] Cazalet et al., (1998) Nat Genet. Nov;36(11):1165-73.