ISHla2

  • Family IS5
  • Group ISH1
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
NC_012030 ND Halorubrum lacusprofundi
Halorubrum lacusprofundi ATCC 49239 plasmid pHLAC01
Halorubrum lacusprofundi ATCC 49239 chromosome 2
DNA section
IS Length : 1193 bp

Ends


IR Length : 20/23

IRL : GGCTCTGTTGAAATCCTTGAAGATTTACATGTTTGTCGTGTAATTCCATG
IRR : GGCTTTGTTGAAATCCTATTGAACTAACACTTTTAGCAGTGACACAGCTG

Insertion site


Left flankDirect repeatRight flankDR Length
AATACGATAATATGTACCTTAAA3
ACGACTGAACGAATATGTTT0
TGATAAATCGTATGTACCTT0

DNA sequence

GGCTCTGTTGAAATCCTTGAAGATTTACATGTTTGTCGTGTAATTCCATGAGATGAAGACCCTCCCGAAGTCGCAGATTCTCCGTTTTACTGAGAAGGCG
ATCCACCTAGCACGCCGAGCAGTCTCTCGATACTCCTCGAAGTTTTCTAAACACCGCTATACACTCCCGCAGCACGTTGTTCTACTGTGTCTCAAAGTTC
GGAAGAACACGACCTATCGTGGTCTGCTTGACGAACTGATCGAGATGCCACGCATTCGTCAAGCTCTTGGATTAACTGAACTACCTACGCCATCAACGCT
CTGTAAGGCGTTCAATCGGCTTGATATGGCTGTATGGCGTGTTGTATTGACTCTCTCAGCGACGCTACTTCCGACGAGTGGAATCGTTGGAGTTGATGCG
TCAGGGTTCGACCGCAGTCACGCCTCAAAACATTACACGAAACGGGCTGAACTCACGATTCAGCAGCTCAAAGTGACGCTGTTGGTAGATACGAAAGTGA
ACGCAATTCTCGATCTGCACGTGACGACGACACGAAAACACGATAGTCAGATCGCTCCATCGTTGGTCAAACGCAACCCCGAGACCATCGACATTCTGCT
CGGTGACAAAGGCTACGACGACCAGAAGATCAGACGACTTGCCCGTCACCACGAGGTTCGGCCACTGATTAAGCATCGTGAGTTCACATCTCTCCACAAG
GCATGGAACGCACGCTTAGACGCTGATCTCTACGGACAGAGAAGTCAATCAGAGACGGTCAACTCAACGCTCAAACGAAAGTACGGTGCCTTCGTTCGCT
CCCGACAATGGTGGAAACAGTTCCGTGAACTCGTTCTTAGATGTCTTGTCCACAATATCGACCGAGCCCTCTAAGATCAGTACAGAGCAAAGGTCCCACA
ATCGTTATCTCATCAGGCATTAACCCATTATGTATGTCAAAAGTAATTTGGACACTTGCTGTAGCATATGGTCTCGTTGGACTCGGTCTATTCTACAGTT
TAGCAGTAGATTCTAGTGAGCTATTTTTAGCCATGACTACCGTCATCTATGTTCTAATGCTTCCATTAGCATATCTAGTCTATAAAAAACGGGTTGTAAG
TGAGTAATCGCTCAAGAAACAGCCAATTCCCACATCTACGTAGCAGCTGTGTCACTGCTAAAAGTGTTAGTTCAATAGGATTTCAACAAAGCC
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
822 bp273 aa53874+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MKTLPKSQILRFTEKAIHLARRAVSRYSSKFSKHRYTLPQHVVLLCLKVRKNTTYRGLLDELIEMPRIRQALGLTELPTPSTLCKAFNRLDMAVWRVVLT
LSATLLPTSGIVGVDASGFDRSHASKHYTKRAELTIQQLKVTLLVDTKVNAILDLHVTTTRKHDSQIAPSLVKRNPETIDILLGDKGYDDQKIRRLARHH
EVRPLIKHREFTSLHKAWNARLDADLYGQRSQSETVNSTLKRKYGAFVRSRQWWKQFRELVLRCLVHNIDRAL

 

Blast result :
Comments
ISHla2 is 62% aa similar to ISH9.
References
1] ISfinder annotation (2010).

2] Lucas,S., Copeland,A., Lapidus,A., Glavina del Rio,T., Dalin,E., Tice,H., Bruce,D., Goodwin,L., Pitluck,S., Sims,D., Brettin,T., Detter,J.C., Han,C., Larimer,F., Land,M., Hauser,L., Kyrpides,N., Ivanova,N., Anderson,I., DasSarma,S., Cavicchioli,R. and Richardson,P. (2009) Direct submission GenBank.