ISPph2

  • Family IS630
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
NC_011060 ND Pelodictyon phaeoclathratiforme
Pelodictyon phaeoclathratiforme BU-1
DNA section
IS Length : 1216 bp

Ends


IR Length : 12

IRL : GTGTCATGTCACGCATAGAAAGTCGTAGATAAAGCGTTAACTTGTTCTTC
IRR : GTGTCATGTCACTCTTCAATTGTCGGATAAAGGCGTAACAGCTTGATTCT

Insertion site


Left flankDirect repeatRight flankDR Length
GGTGCCCCTGTATGCTTTGTGT2

DNA sequence

GTGTCATGTCACGCATAGAAAGTCGTAGATAAAGCGTTAACTTGTTCTTCATAATCATCCAACCAAAATTTGACTATGAAGAAGTACAAAGTGACCCTGA
CACAAGAGGAACGAAAGGAACTGGATGCACTCAGCAGCAAAGGAAAGCACGCAGCTCATACCATGCTGAATTCCTTGATTTTAATGGCATGTGATGAGGG
CGAATACCAGACTGAGCGATCAATCAATGAAACCATTTCTCGTGTTCTGAATGTCAGCATGAAAACGATAGACCGGGTAAAAAAACGATTTGTAGAAGAG
GGTTTTGATATGGCACTTACCGGCAAACCCTCAACAAGAGTGTACAGACGGAAAGCGGATGGTGATTTGGAAGCTCATTTAGTGGCGCTGAGCTGCTCAG
CCGCACCTGAAGGACATCAACGCTGGACTCTGAGATTATTGGCAGATAAAGCTGTTGAGCTGGACTATGTGGACAGTATCTCATATGAGACAGTCCGAAG
GGTTTTAAAAAAAACGTCATTAAACCCTGGAAGAAGGATGGGTGGATAATTCCGCCACTCGGTGATGGGAATTTTGTAGCACACATGGAGATGGTACTGG
ACGTTTATAAGCAACCCTATGATCCACTGTACCCGGTTGTCTGCATGGATGAATCACCAAAACAGTTGATTGCTGAAACAAGAATACCGATACCGGCAAC
TCCTGGGCAGTTGGCCAGATATGATTATGAATACAGCCTGAAAGGTACTTGCATCATTTTCATGGCCAATGAACCGTTGGTTGGCAAGCGGATGGTTCGA
ATAACGACAAACAGAAAAAGAGTTGACTGGGCAAGATTCCTTGAAGAAATAGCCAATCAGTACAAGAATGCAGAACGGATCATGCTGGTGATGGACAATC
TGAATACACATGAGCCCGGTTCATTCTATCATGCATTTAACCCGGAAAAAGCAAAGGCATTATTGGACAGGTTTGAATTTGTGTATACCCCGAAACACGG
AAGTTGGTTGAATATGGCAGAGATAGAATTGAGAGTCTTGACGACTCAGTGTTTGGATCGTCGCATTGATACGATTACAAAAGTCAGGTCGGAAGTAGCC
GCATGGGAGATGAAACGCAACAATAATAATTCCAAGATAAATTGGCGTTTTACAAACGAAAAGGCGAGAATCAAGCTGTTACGCCTTTATCCGACAATTG
AAGAGTGACATGACAC
Recoding section
  • Recoding by frameshift
  • Frame
  • Type
  • Experimentally demonstrated

Stimulators :

  • Shine-Dalgarno sequence :
  • Secondary structure :

Recoding motif :

Protein section
ORF number : 3

 

ORF 1
LengthBeginEndStrandFusion ORF
471 bp157 aa76546+No
ORF function : Transposase
Description : First part of the transposase

ORF sequence :

MKKYKVTLTQEERKELDALSSKGKHAAHTMLNSLILMACDEGEYQTERSINETISRVLNVSMKTIDRVKKRFVEEGFDMALTGKPSTRVYRRKADGDLEA
HLVALSCSAAPEGHQRWTLRLLADKAVELDYVDSISYETVRRVLKKTSLNPGRRMGG

 

Blast result :
ORF 2
LengthBeginEndStrandFusion ORF
720 bp239 aa4891208+No
ORF function : Transposase
Description : Second part of the transposase

ORF sequence :

DSPKGFKKNVIKPWKKDGWIIPPLGDGNFVAHMEMVLDVYKQPYDPLYPVVCMDESPKQLIAETRIPIPATPGQLARYDYEYSLKGTCIIFMANEPLVGK
RMVRITTNRKRVDWARFLEEIANQYKNAERIMLVMDNLNTHEPGSFYHAFNPEKAKALLDRFEFVYTPKHGSWLNMAEIELRVLTTQCLDRRIDTITKVR
SEVAAWEMKRNNNNSKINWRFTNEKARIKLLRLYPTIEE

 

Blast result :
ORF 3
LengthBeginEndStrandFusion ORF
1133 bp369 aa761208+Yes
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MKKYKVTLTQEERKELDALSSKGKHAAHTMLNSLILMACDEGEYQTERSINETISRVLNVSMKTIDRVKKRFVEEGFDMALTGKPSTRVYRRKADGDLEA
HLVALSCSAAPEGHQRWTLRLLADKAVELDYVDSISYETVRRVLKKDGWIIPPLGDGNFVAHMEMVLDVYKQPYDPLYPVVCMDESPKQLIAETRIPIPA
TPGQLARYDYEYSLKGTCIIFMANEPLVGKRMVRITTNRKRVDWARFLEEIANQYKNAERIMLVMDNLNTHEPGSFYHAFNPEKAKALLDRFEFVYTPKH
GSWLNMAEIELRVLTTQCLDRRIDTITKVRSEVAAWEMKRNNNNSKINWRFTNEKARIKLLRLYPTIEE

 

Blast result :
Comments
ISPph2 is 80% aa similar to ISArch4. The third ORF is a putative ORFAB transposase reconstructed in silico by possible -1 frameshift.
References
1] ISfinder annotation (2010)
2] Lucas,S., Copeland,A., Lapidus,A., Glavina del Rio,T., Dalin,E., Tice,H., Bruce,D., Goodwin,L., Pitluck,S., Schmutz,J., Larimer,F., Land,M., Hauser,L., Kyrpides,N., Mikhailova,N., Liu,Z., Li,T., Zhao,F., Overmann,J., Bryant,D.A. and Richardson,P. (2008) Direct submission GenBank.