ISPko1

  • Family IS5
  • Group IS903
MGE type ISRelated element(s) :
Isoform Synonym(s) ISPkr2
Accession numberTranspositionOriginHost
GQ868751 Y Paracoccus kondratievae
Paracoccus koreensis JCM 21670
Paracoccus kondratievae NCIMB 13773
DNA section
IS Length : 1050 bp

Ends


IR Length : 18

IRL : GGCTCTGTTGCACAAATCCCGTGTGGGATTCATCTCATGAATCCAGCGTG
IRR : GGCTCTGTTGCACAAATCGGCTGATGGCCTGGGTTCCCCTTTCCCCGGAC

Insertion site


Left flankDirect repeatRight flankDR Length
TAAATCTATCACCGCAAGGGATAAATATC9

DNA sequence

GGCTCTGTTGCACAAATCCCGTGTGGGATTCATCTCATGAATCCAGCGTGGTAGCTGGGATACATGAGCAGACCTACACCCCCGACCTACAGGACCAGGA
ACTGGCCAGCCTACAATGAAGCGCTCAAGCGCCGCGGCTCGCTGACGATCTGGTTCGATCCCGAGATGAGCTGGGATGCCGCGCCGACAGGTAGGCGTGG
CCGCCAGCAGACCTACAGCGATGCCGCCATCCAGACATGCCTTTCGATGAAGGTGCTGTTCGGCATGGCGCTTCGGCAGACGACAGGCTTCGTCGAAAGC
CTACTGCGGCTGGTCGGCCTCGACTGGGCGGTGCCCGACTTCAGCACCCTGTCCCGCCGCCAGAAGACCCTGGCCGTGAACATCCCGTATCGCGGCTCCA
AGGGGCCGCTGCACCTGCTGATCGACAGCACGGGTATCAAAGTCGAGGGCGAAGGCGAGTGGCACGCCCGCAAGCATGGCGGCCCGAAACGGCGCGTCTG
GCGCAAGATCCATCTCGGGATCGACGAGGAAACACTGGAGGTTCGCGCAGTCGAGGTCACAGGTAGCCATATCGGCGATGCACCGGTCTTACCCGACCTG
CTCAACCAGATCCCAGCGTACGAGCAGATCAGCAGCGTCACTGCCGACGGTGCCTACGACACCCGCAAATGCCACGATGCAATCGCTGACCGCGGCGCCC
GCGCTGTCATTCCGCCTCGCAAGAATGCCAAGCCGTGGAAGACCGTCACCGCCGGCGCGGTCGCACGAAACGAAGCGCTGCGGGCATCGAAATACCTCGG
TCGTGCTCTCTGGCGACGATGGAGCGGATACCACCGCCGAAGCCGCGTCGAAACGAAGATGCACTGTGTGAAACTGCTGGGGCAGCGCCTCATGGCGCGG
GACTTCGACCGACAGGTCGCGGAGCTTCAGGTCCGTATCGCCGTTCTGAACGGCTACACCGCGCTCGGCATCCCTGTCACAGAGCCCGTGGGATAAGTCT
GTCCGGGGAAAGGGGAACCCAGGCCATCAGCCGATTTGTGCAACAGAGCC
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
933 bp310 aa64996+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MSRPTPPTYRTRNWPAYNEALKRRGSLTIWFDPEMSWDAAPTGRRGRQQTYSDAAIQTCLSMKVLFGMALRQTTGFVESLLRLVGLDWAVPDFSTLSRRQ
KTLAVNIPYRGSKGPLHLLIDSTGIKVEGEGEWHARKHGGPKRRVWRKIHLGIDEETLEVRAVEVTGSHIGDAPVLPDLLNQIPAYEQISSVTADGAYDT
RKCHDAIADRGARAVIPPRKNAKPWKTVTAGAVARNEALRASKYLGRALWRRWSGYHRRSRVETKMHCVKLLGQRLMARDFDRQVAELQVRIAVLNGYTA
LGIPVTEPVG

 

Blast result :
Comments
ISPko1 is 94% aa similar to ISRusp1.
ISPko1 has been identified by its transposition to the entrapment vector pMEC1 (cI-tetA cassette). ISPko1 contains two sequences, 5’-GCTGGTcG-3’ (position 309, 1 mismatch) and 5’-GCTGaTcG-3’ (position 417, 2 mismatch), similar to Chi sites, which specify the place of action for RecBCD nuclease.
References
1] Dziewit, L., Baj, J., Szuplewska, M., Maj A., Tabin, M., Czyzkowska, A., Skrzypczyk, G., Adamczuk, M., Sitarek, T., Stawinski, P., Tudek, A., Wanasz, K., Wardal, E., Piechucka, E., Bartosik, D. (2012) PLoS ONE 7: e32277